Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06474
Gene name
Locationscaffold_08:190398..191855
Strand+
Gene length (bp)1457
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01331 mRNA_cap_enzyme mRNA capping enzyme, catalytic domain 1.0E-53 75 270
PF03919 mRNA_cap_C mRNA capping enzyme, C-terminal domain 2.3E-32 274 398

GO

GO Term Description Terminal node
GO:0004484 mRNA guanylyltransferase activity Yes
GO:0005524 ATP binding Yes
GO:0006370 7-methylguanosine mRNA capping Yes
GO:0008152 metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No
GO:0043170 macromolecule metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0070568 guanylyltransferase activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0036260 RNA capping No
GO:0016779 nucleotidyltransferase activity No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0009987 cellular process No
GO:0006396 RNA processing No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:0009452 7-methylguanosine RNA capping No
GO:0006397 mRNA processing No
GO:0071704 organic substance metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0008192 RNA guanylyltransferase activity No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0016071 mRNA metabolic process No
GO:0036094 small molecule binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0000166 nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0090304 nucleic acid metabolic process No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.393 0.621 0.2385 0.011 0.137 0.0063 0.336 0.024 0.0376 0.0397

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5536
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4519
Ophiocordyceps australis map64 (Brazil) OphauB2|6160
Ophiocordyceps camponoti-floridani Ophcf2|06474 (this protein)
Ophiocordyceps kimflemingae Ophio5|6748
Ophiocordyceps subramaniannii Hirsu2|693

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06474
MASKDQSIHKARYEHSDPLHRSTDRVRHAMDQPPEGPIGSIAEPGLKAEGPLLYSMRKEVAELLGRHQTSFPGAQ
PVSFARQHLDELTRQDYYVCEKSDGIRYLLYSTEDETGGEAHYLIDRKNDYWFIHNRNLHFPLVNDLSAFHTATL
VDGELVWDSLSSGKKEPRFLVFDCLVMDGNKLMDRTLDKRLAYFNERLYTPYNKLFKEFPHERQFQPFFVDMKPF
QLAYGIEMMFKQVLPSLKHGNDGLIFTCRNTAYKHGTDPHILKWKPPEENTIDFRLKLIFPTVEPDERERKDGIT
EPFVDYDSVPKAEVLIYKGDSGPDRYEAFSDLFLSEDEWETLKGLNDPLNDRIVECNLDEQGRWRLVRFRDDKSE
ANHKSTVQSVLESISDRVSEKDLYRAAGPIRDSWKARQARADSESRRGR*
Coding >Ophcf2|06474
ATGGCCTCAAAAGACCAGTCCATTCACAAGGCCCGATATGAGCACTCAGATCCTTTACACCGTTCGACCGATCGA
GTCCGGCACGCCATGGACCAGCCTCCCGAAGGGCCGATCGGCTCCATCGCCGAGCCAGGCCTCAAGGCCGAAGGG
CCGCTACTGTATTCGATGCGCAAAGAGGTGGCCGAGCTTTTGGGGCGTCACCAGACCAGCTTTCCTGGGGCGCAG
CCCGTCAGTTTCGCGAGGCAGCATCTCGACGAGCTCACGAGACAAGATTATTACGTGTGCGAAAAGTCGGACGGC
ATTCGATACCTCCTCTACTCGACCGAGGACGAGACCGGCGGAGAGGCGCATTACCTGATCGACCGCAAGAACGAT
TATTGGTTCATCCACAATCGAAATCTTCATTTTCCTCTGGTAAACGATCTCAGCGCCTTTCACACGGCGACGCTC
GTCGACGGCGAGCTCGTGTGGGACAGTCTGTCCAGCGGGAAAAAGGAGCCGCGATTTCTCGTGTTTGATTGCCTG
GTCATGGATGGGAATAAACTCATGGACCGAACGTTAGATAAGCGCCTGGCCTACTTCAACGAGCGGCTTTACACG
CCCTACAACAAGTTGTTCAAAGAGTTTCCTCATGAACGTCAGTTTCAGCCGTTCTTCGTCGACATGAAGCCCTTC
CAGCTGGCGTACGGTATCGAGATGATGTTCAAGCAGGTTCTCCCAAGCCTCAAACACGGTAACGACGGTCTCATA
TTCACGTGTCGCAACACAGCCTACAAGCATGGCACGGATCCACATATTCTGAAGTGGAAACCTCCGGAGGAAAAC
ACCATCGACTTTCGACTGAAGCTCATCTTTCCGACCGTCGAGCCGGACGAGCGGGAGAGGAAAGACGGGATCACA
GAGCCCTTTGTCGACTACGACAGCGTGCCCAAGGCAGAGGTTCTCATATACAAGGGAGACAGCGGTCCGGATCGG
TACGAGGCCTTTAGCGACCTCTTTCTCTCCGAGGATGAGTGGGAGACGTTGAAGGGTCTGAATGATCCTCTCAAC
GACCGCATTGTCGAGTGCAATCTCGATGAACAGGGTCGATGGAGGCTGGTGCGCTTCCGGGACGATAAGAGCGAG
GCAAACCACAAGAGCACGGTCCAGAGCGTTCTCGAGAGCATCAGCGACCGTGTCTCGGAGAAGGATCTCTACAGA
GCAGCGGGCCCCATCAGAGATAGTTGGAAGGCCCGTCAAGCCCGTGCTGATTCGGAGAGCAGGCGTGGGAGGTAG
Transcript >Ophcf2|06474
ATGGCCTCAAAAGACCAGTCCATTCACAAGGCCCGATATGAGCACTCAGATCCTTTACACCGTTCGACCGATCGA
GTCCGGCACGCCATGGACCAGCCTCCCGAAGGGCCGATCGGCTCCATCGCCGAGCCAGGCCTCAAGGCCGAAGGG
CCGCTACTGTATTCGATGCGCAAAGAGGTGGCCGAGCTTTTGGGGCGTCACCAGACCAGCTTTCCTGGGGCGCAG
CCCGTCAGTTTCGCGAGGCAGCATCTCGACGAGCTCACGAGACAAGATTATTACGTGTGCGAAAAGTCGGACGGC
ATTCGATACCTCCTCTACTCGACCGAGGACGAGACCGGCGGAGAGGCGCATTACCTGATCGACCGCAAGAACGAT
TATTGGTTCATCCACAATCGAAATCTTCATTTTCCTCTGGTAAACGATCTCAGCGCCTTTCACACGGCGACGCTC
GTCGACGGCGAGCTCGTGTGGGACAGTCTGTCCAGCGGGAAAAAGGAGCCGCGATTTCTCGTGTTTGATTGCCTG
GTCATGGATGGGAATAAACTCATGGACCGAACGTTAGATAAGCGCCTGGCCTACTTCAACGAGCGGCTTTACACG
CCCTACAACAAGTTGTTCAAAGAGTTTCCTCATGAACGTCAGTTTCAGCCGTTCTTCGTCGACATGAAGCCCTTC
CAGCTGGCGTACGGTATCGAGATGATGTTCAAGCAGGTTCTCCCAAGCCTCAAACACGGTAACGACGGTCTCATA
TTCACGTGTCGCAACACAGCCTACAAGCATGGCACGGATCCACATATTCTGAAGTGGAAACCTCCGGAGGAAAAC
ACCATCGACTTTCGACTGAAGCTCATCTTTCCGACCGTCGAGCCGGACGAGCGGGAGAGGAAAGACGGGATCACA
GAGCCCTTTGTCGACTACGACAGCGTGCCCAAGGCAGAGGTTCTCATATACAAGGGAGACAGCGGTCCGGATCGG
TACGAGGCCTTTAGCGACCTCTTTCTCTCCGAGGATGAGTGGGAGACGTTGAAGGGTCTGAATGATCCTCTCAAC
GACCGCATTGTCGAGTGCAATCTCGATGAACAGGGTCGATGGAGGCTGGTGCGCTTCCGGGACGATAAGAGCGAG
GCAAACCACAAGAGCACGGTCCAGAGCGTTCTCGAGAGCATCAGCGACCGTGTCTCGGAGAAGGATCTCTACAGA
GCAGCGGGCCCCATCAGAGATAGTTGGAAGGCCCGTCAAGCCCGTGCTGATTCGGAGAGCAGGCGTGGGAGGTAG
Gene >Ophcf2|06474
ATGGCCTCAAAAGACCAGTCCATTCACAAGGCCCGATATGGTTGGACTCCATTGCGCCATGTGCCTAAACAAGAC
TCTGCGTGCTGCTTCCTAGTTCTCAGAGCACTCAGATCCTTTGTGAGTCTCGCCTCGACCTGCGATAAGCCGCTC
CGACGCTGACTCGTTGCGCCAACCGCCAGACACCGTTCGACCGATCGAGTCCGGCACGCCATGGACCAGCCTCCC
GAAGGGCCGATCGGCTCCATCGCCGAGCCAGGCCTCAAGGCCGAAGGGCCGCTACTGTATTCGATGCGCAAAGAG
GTGGCCGAGCTTTTGGGGCGTCACCAGACCAGCTTTCCTGGGGCGCAGCCCGTCAGTTTCGCGAGGCAGCATCTC
GACGAGCTCACGAGACAAGAGTACGGATGCAGACAGAACCTCCCCGGATAGACGTTGGTTCATGCTGATGGAGTG
CCAGTTATTACGTGTGCGAAAAGTCGGACGGCATTCGATACCTCCTCTACTCGACCGAGGACGAGACCGGCGGAG
AGGCGCATTACCTGATCGACCGCAAGAACGATTATTGGTTCATCCACAATCGAAATCTTCATTTTCCTCTGGTAA
ACGATCTCAGCGCCTTTCACACGGCGACGCTCGTCGACGGCGAGCTCGTGTGGGACAGTCTGTCCAGCGGGAAAA
AGGAGCCGCGATTTCTCGTGTTTGATTGCCTGGTCATGGATGGGAATAAACTCATGGACCGAACGTTAGATAAGC
GCCTGGCCTACTTCAACGAGCGGCTTTACACGCCCTACAACAAGTTGTTCAAAGAGTTTCCTCATGAACGTCAGT
TTCAGCCGTTCTTCGTCGACATGAAGCCCTTCCAGCTGGCGTACGGTATCGAGATGATGTTCAAGCAGGTTCTCC
CAAGCCTCAAACACGGTAACGACGGTCTCATATTCACGTGTCGCAACACAGCCTACAAGCATGGCACGGATCCAC
ATATTCTGAAGTGGAAACCTCCGGAGGAAAACACCATCGACTTTCGACTGAAGCTCATCTTTCCGACCGTCGAGC
CGGACGAGCGGGAGAGGAAAGACGGGATCACAGAGCCCTTTGTCGACTACGACAGCGTGCCCAAGGCAGAGGTTC
TCATATACAAGGGAGACAGCGGTCCGGATCGGTACGAGGCCTTTAGCGACCTCTTTCTCTCCGAGGATGAGTGGG
AGACGTTGAAGGGTCTGAATGATCCTCTCAACGACCGCATTGTCGAGTGCAATCTCGATGAACAGGGTCGATGGA
GGCTGGTGCGCTTCCGGGACGATAAGAGCGAGGCAAACCACAAGAGCACGGTCCAGAGCGTTCTCGAGAGCATCA
GCGACCGTGTCTCGGAGAAGGATCTCTACAGAGCAGCGGGCCCCATCAGAGATAGTTGGAAGGCCCGTCAAGCCC
GTGCTGATTCGGAGAGCAGGCGTGGGAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail