Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06452
Gene name
Locationscaffold_08:6795..10681
Strand+
Gene length (bp)3886
Transcript length (bp)2700
Coding sequence length (bp)2700
Protein length (aa) 900

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02731 SKIP_SNW SKIP/SNW domain 6.8E-67 190 348

GO

GO Term Description Terminal node
GO:0005681 spliceosomal complex Yes
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:0006397 mRNA processing No
GO:0044237 cellular metabolic process No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:1901360 organic cyclic compound metabolic process No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:1990904 ribonucleoprotein complex No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0008380 RNA splicing No
GO:0090304 nucleic acid metabolic process No
GO:0016071 mRNA metabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 566 588 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06452
MASIAASLQASLPQPKYTGGNEEEESRSQQRGPRIVSAGQLDESQVVLRRTGPPPYGQREGWRPRSQEDYGDGGA
FPEVPVAQYPLDMGRKHGVKSNALAIQVDSEGKVKYDAIARRGHGDGRIIHTSFKDLIPLRQRADAGEIDLARPD
KETVAATTEKTKNALTALISGAVAAQKPKNINVGQRKEATFVRYTPANQMGDNSKKQDRIIKIVERQRDPMEPPK
FKHKKIPRGPPSPPPPVMRSPPRKLTAEDQEMWRIPPPVSNWKNPKGFTVPLDKRLAADGRGLHDVTINDKHAQF
AEAVKMAERHAREEVQQRALMQQRLAEQEKARKDDSLRALALKTREERLAQSSSRGRRESRTSGSRSRSRSHSSS
EPRKNLTAKTPRSANAKGPTRAAQGRRAQTAAEQNGRRAADPGHGTRAGTRHLGEDCAGAGEADSIQGEHDSTSL
QPIRGFDSGFNEDNHYDKPLFAAQDAISSIYRPRANVNDDGFDDDAGDKEMAKIHKISRFGEALGKGPFEARPMP
STKKKSITSRGLPQYEDMDFGESRTTKTAAWWKPRYWRKRTWAIVAGVFIVIIAVVVAVAVALSGLTNYPDYKAV
SYALRDTYEGENFFDQFNYFTGWDPTKGFVHYVPRPQAQQLNLTYASTNTAIVRVDTSVGPGSRPDASTGRFSVR
LESKKTYGGGLFVFDVKHTPHACGTWPALWLTDPSHWPDHGEIDIMESINNGAGGNQMSLHTADGCSMAVTRKMK
GHALHNDCNQASNGNAGCGVTGGRNSFGPALNAAGGSVMAVEWREAGIRVWQFGRGDVPSDVVAKRPNPAGWGTA
TADFPNTRCGIGSMFRNNSIVIDIDLCGDMVYGTWDRSSCPSTCTDLVSNQPALFKTAYWEFGSFQVYQPASPS*
Coding >Ophcf2|06452
ATGGCCTCGATTGCCGCATCTCTCCAGGCTTCGCTGCCGCAGCCGAAATACACGGGAGGAAATGAGGAAGAAGAA
TCTCGATCGCAGCAGCGCGGCCCGCGTATCGTCAGCGCCGGCCAGCTGGACGAGAGCCAGGTTGTGCTAAGACGA
ACGGGACCGCCGCCTTATGGCCAGCGAGAAGGCTGGAGGCCACGGTCACAGGAGGACTATGGAGATGGAGGCGCG
TTTCCCGAGGTTCCGGTGGCTCAGTATCCGCTCGACATGGGCAGGAAGCACGGAGTCAAGAGCAACGCGTTGGCG
ATACAGGTCGATTCTGAGGGCAAAGTCAAGTATGACGCCATCGCGAGACGCGGCCACGGCGACGGCCGGATCATC
CACACGTCCTTTAAGGATCTCATTCCGTTGCGGCAGCGGGCTGACGCTGGCGAGATCGATCTCGCCCGGCCAGAC
AAGGAGACGGTGGCGGCGACGACAGAAAAGACCAAGAACGCCTTGACCGCACTCATCAGCGGCGCCGTGGCAGCG
CAGAAGCCAAAGAATATCAACGTCGGACAGCGAAAGGAAGCCACCTTTGTGCGCTACACGCCGGCCAACCAAATG
GGCGATAATTCCAAGAAGCAGGACCGCATCATCAAGATTGTCGAGCGACAACGCGATCCCATGGAGCCGCCCAAG
TTCAAGCACAAGAAGATCCCCCGCGGTCCTCCTTCACCGCCGCCGCCTGTGATGCGCTCGCCGCCCCGGAAGCTT
ACAGCCGAGGATCAAGAGATGTGGAGGATCCCTCCGCCCGTGTCCAACTGGAAGAACCCCAAGGGCTTTACCGTT
CCTCTGGATAAGCGTCTGGCCGCTGACGGTCGTGGTCTGCACGACGTGACCATCAACGACAAGCACGCGCAATTC
GCCGAGGCCGTCAAGATGGCCGAACGGCACGCGCGCGAGGAGGTGCAGCAGCGGGCCCTGATGCAGCAGCGGCTC
GCGGAGCAGGAGAAGGCTCGAAAGGATGACAGCCTCCGGGCATTGGCGCTGAAGACGCGCGAAGAGCGACTCGCT
CAGTCATCAAGTCGCGGAAGAAGAGAGTCGAGGACGTCTGGGTCACGGTCACGGTCGCGAAGCCACAGCTCCTCC
GAGCCTCGGAAGAATCTGACAGCGAAGACGCCGAGATCCGCGAACGCGAAAGGCCCGACGCGAGCGGCGCAAGGA
AGAAGAGCGCAAACTGCGGCAGAACAGAATGGGCGCAGAGCGGCGGATCCAGGTCATGGCACGAGAGCAGGGACG
CGACATCTCGGAGAAGATTGCGCTGGGGCTGGCGAAGCCGACTCAATCCAAGGAGAGCACGACTCCACGTCTCTT
CAACCGATCAGGGGCTTCGACAGCGGCTTTAACGAGGACAACCATTACGATAAGCCGCTGTTCGCTGCTCAGGAC
GCCATCTCCAGCATCTACCGTCCGCGAGCCAACGTCAATGACGACGGCTTCGACGACGACGCGGGCGACAAGGAG
ATGGCCAAGATTCACAAGATTAGCCGCTTCGGCGAGGCTCTCGGCAAGGGACCTTTCGAGGCGCGGCCGATGCCG
AGCACGAAGAAGAAGTCGATCACAAGTCGGGGTCTTCCCCAATACGAGGACATGGACTTTGGCGAGTCACGGACG
ACGAAGACGGCGGCTTGGTGGAAGCCGCGGTACTGGCGGAAGCGAACCTGGGCTATTGTCGCGGGCGTCTTCATC
GTCATCATTGCCGTCGTTGTGGCTGTTGCCGTTGCCTTGTCTGGCTTGACGAATTATCCGGATTATAAGGCTGTG
TCGTACGCTTTGCGAGATACCTATGAGGGGGAAAACTTCTTTGATCAGTTCAATTACTTTACCGGCTGGGATCCC
ACCAAGGGCTTCGTTCATTATGTTCCACGACCGCAGGCTCAACAGCTGAACCTAACGTACGCGTCAACCAACACA
GCCATCGTGAGAGTCGACACCTCAGTCGGTCCCGGATCCAGACCCGATGCCTCAACAGGCCGCTTCTCCGTAAGA
CTCGAGTCAAAGAAGACGTACGGAGGCGGCCTCTTCGTCTTCGACGTCAAGCACACGCCTCACGCTTGCGGCACC
TGGCCAGCCCTCTGGCTAACGGACCCATCCCACTGGCCAGACCACGGAGAGATCGACATCATGGAGTCGATCAAC
AACGGCGCGGGCGGGAACCAGATGTCGCTGCATACGGCGGATGGGTGTTCCATGGCCGTGACGCGCAAGATGAAG
GGCCACGCGCTGCACAATGACTGCAATCAGGCTAGTAACGGCAACGCCGGCTGTGGCGTCACCGGCGGGCGCAAC
TCGTTTGGTCCTGCTCTGAACGCTGCTGGCGGGAGCGTCATGGCGGTTGAGTGGCGAGAAGCCGGCATTCGGGTT
TGGCAGTTTGGTCGTGGAGATGTGCCGTCTGATGTTGTGGCCAAGAGGCCTAACCCTGCTGGTTGGGGCACTGCC
ACGGCTGATTTTCCGAATACTCGCTGTGGCATTGGCTCGATGTTCCGGAACAACTCCATCGTCATCGATATCGAT
CTGTGCGGTGATATGGTATATGGCACCTGGGATCGTTCGTCGTGCCCGAGCACCTGCACTGATCTCGTGTCCAAC
CAGCCCGCCCTCTTCAAGACGGCGTACTGGGAGTTTGGCTCCTTTCAAGTCTACCAACCGGCGTCTCCGTCGTGA
Transcript >Ophcf2|06452
ATGGCCTCGATTGCCGCATCTCTCCAGGCTTCGCTGCCGCAGCCGAAATACACGGGAGGAAATGAGGAAGAAGAA
TCTCGATCGCAGCAGCGCGGCCCGCGTATCGTCAGCGCCGGCCAGCTGGACGAGAGCCAGGTTGTGCTAAGACGA
ACGGGACCGCCGCCTTATGGCCAGCGAGAAGGCTGGAGGCCACGGTCACAGGAGGACTATGGAGATGGAGGCGCG
TTTCCCGAGGTTCCGGTGGCTCAGTATCCGCTCGACATGGGCAGGAAGCACGGAGTCAAGAGCAACGCGTTGGCG
ATACAGGTCGATTCTGAGGGCAAAGTCAAGTATGACGCCATCGCGAGACGCGGCCACGGCGACGGCCGGATCATC
CACACGTCCTTTAAGGATCTCATTCCGTTGCGGCAGCGGGCTGACGCTGGCGAGATCGATCTCGCCCGGCCAGAC
AAGGAGACGGTGGCGGCGACGACAGAAAAGACCAAGAACGCCTTGACCGCACTCATCAGCGGCGCCGTGGCAGCG
CAGAAGCCAAAGAATATCAACGTCGGACAGCGAAAGGAAGCCACCTTTGTGCGCTACACGCCGGCCAACCAAATG
GGCGATAATTCCAAGAAGCAGGACCGCATCATCAAGATTGTCGAGCGACAACGCGATCCCATGGAGCCGCCCAAG
TTCAAGCACAAGAAGATCCCCCGCGGTCCTCCTTCACCGCCGCCGCCTGTGATGCGCTCGCCGCCCCGGAAGCTT
ACAGCCGAGGATCAAGAGATGTGGAGGATCCCTCCGCCCGTGTCCAACTGGAAGAACCCCAAGGGCTTTACCGTT
CCTCTGGATAAGCGTCTGGCCGCTGACGGTCGTGGTCTGCACGACGTGACCATCAACGACAAGCACGCGCAATTC
GCCGAGGCCGTCAAGATGGCCGAACGGCACGCGCGCGAGGAGGTGCAGCAGCGGGCCCTGATGCAGCAGCGGCTC
GCGGAGCAGGAGAAGGCTCGAAAGGATGACAGCCTCCGGGCATTGGCGCTGAAGACGCGCGAAGAGCGACTCGCT
CAGTCATCAAGTCGCGGAAGAAGAGAGTCGAGGACGTCTGGGTCACGGTCACGGTCGCGAAGCCACAGCTCCTCC
GAGCCTCGGAAGAATCTGACAGCGAAGACGCCGAGATCCGCGAACGCGAAAGGCCCGACGCGAGCGGCGCAAGGA
AGAAGAGCGCAAACTGCGGCAGAACAGAATGGGCGCAGAGCGGCGGATCCAGGTCATGGCACGAGAGCAGGGACG
CGACATCTCGGAGAAGATTGCGCTGGGGCTGGCGAAGCCGACTCAATCCAAGGAGAGCACGACTCCACGTCTCTT
CAACCGATCAGGGGCTTCGACAGCGGCTTTAACGAGGACAACCATTACGATAAGCCGCTGTTCGCTGCTCAGGAC
GCCATCTCCAGCATCTACCGTCCGCGAGCCAACGTCAATGACGACGGCTTCGACGACGACGCGGGCGACAAGGAG
ATGGCCAAGATTCACAAGATTAGCCGCTTCGGCGAGGCTCTCGGCAAGGGACCTTTCGAGGCGCGGCCGATGCCG
AGCACGAAGAAGAAGTCGATCACAAGTCGGGGTCTTCCCCAATACGAGGACATGGACTTTGGCGAGTCACGGACG
ACGAAGACGGCGGCTTGGTGGAAGCCGCGGTACTGGCGGAAGCGAACCTGGGCTATTGTCGCGGGCGTCTTCATC
GTCATCATTGCCGTCGTTGTGGCTGTTGCCGTTGCCTTGTCTGGCTTGACGAATTATCCGGATTATAAGGCTGTG
TCGTACGCTTTGCGAGATACCTATGAGGGGGAAAACTTCTTTGATCAGTTCAATTACTTTACCGGCTGGGATCCC
ACCAAGGGCTTCGTTCATTATGTTCCACGACCGCAGGCTCAACAGCTGAACCTAACGTACGCGTCAACCAACACA
GCCATCGTGAGAGTCGACACCTCAGTCGGTCCCGGATCCAGACCCGATGCCTCAACAGGCCGCTTCTCCGTAAGA
CTCGAGTCAAAGAAGACGTACGGAGGCGGCCTCTTCGTCTTCGACGTCAAGCACACGCCTCACGCTTGCGGCACC
TGGCCAGCCCTCTGGCTAACGGACCCATCCCACTGGCCAGACCACGGAGAGATCGACATCATGGAGTCGATCAAC
AACGGCGCGGGCGGGAACCAGATGTCGCTGCATACGGCGGATGGGTGTTCCATGGCCGTGACGCGCAAGATGAAG
GGCCACGCGCTGCACAATGACTGCAATCAGGCTAGTAACGGCAACGCCGGCTGTGGCGTCACCGGCGGGCGCAAC
TCGTTTGGTCCTGCTCTGAACGCTGCTGGCGGGAGCGTCATGGCGGTTGAGTGGCGAGAAGCCGGCATTCGGGTT
TGGCAGTTTGGTCGTGGAGATGTGCCGTCTGATGTTGTGGCCAAGAGGCCTAACCCTGCTGGTTGGGGCACTGCC
ACGGCTGATTTTCCGAATACTCGCTGTGGCATTGGCTCGATGTTCCGGAACAACTCCATCGTCATCGATATCGAT
CTGTGCGGTGATATGGTATATGGCACCTGGGATCGTTCGTCGTGCCCGAGCACCTGCACTGATCTCGTGTCCAAC
CAGCCCGCCCTCTTCAAGACGGCGTACTGGGAGTTTGGCTCCTTTCAAGTCTACCAACCGGCGTCTCCGTCGTGA
Gene >Ophcf2|06452
ATGGCCTCGATTGCCGCATCTCTCCAGGCTTCGCTGCCGCAGCCGAAATACACGGGAGGAAATGAGGAAGAAGAA
TCTCGATCGCAGCAGCGCGGCCCGCGTATCGTCAGCGCCGGCCAGCTGGACGAGAGCCAGGTTGTGCTAAGACGA
ACGGGACCGCCGCCTTATGGCCAGCGAGAAGGCTGGAGGCCACGGTCACAGGAGGACTATGGAGATGGAGGCGCG
TTTCCCGAGGTTCCGGTGGCTCAGTATCCGCTCGACATGGGCAGGAAGCACGGAGTCAAGAGCAACGCGTTGGCG
ATACAGGTCGATTCTGAGGGCAAAGTCAAGTATGACGCCATCGCGAGACGCGGCCACGGCGACGGCCGGATCATC
CACACGTCCTTTAAGGATCTCATTCCGTTGCGGCAGCGGGCTGACGCTGGCGAGATCGATCTCGCCCGGCCAGAC
AAGGAGACGGTGGCGGCGACGACAGAAAAGACCAAGAACGCCTTGACCGCACTCATCAGCGGCGCCGTGGCAGCG
CAGAAGCCAAAGAATATCAACGTCGGACAGCGAAAGGAAGCCACCTTTGTGCGCTACACGCCGGCCAACCAAATG
GGCGATAATTCCAAGAAGCAGGACCGCATCATCAAGATTGTCGAGCGACAACGCGATCCCATGGAGCCGCCCAAG
TTCAAGCACAAGAAGATCCCCCGCGGTCCTCCTTCACCGCCGCCGCCTGTGATGCGCTCGCCGCCCCGGAAGCTT
ACAGCCGAGGATCAAGAGATGTGGAGGATCCCTCCGCCCGTGTCCAACTGGAAGAACCCCAAGGGCTTTACCGTT
CCTCTGGATAAGCGTCTGGCCGCTGACGGTCGTGGTCTGCACGACGTGACCATCAACGACAAGCACGCGCAATTC
GCCGAGGCCGTCAAGATGGCCGAACGGCACGCGCGCGAGGAGGTGCAGCAGCGGGCCCTGATGCAGCAGCGGCTC
GCGGAGCAGGAGAAGGCTCGAAAGGATGACAGCCTCCGGGCATTGGCGCTGAAGACGCGCGAAGAGCGACTCGCT
CAGTCATCAAGTCGCGGAAGAAGAGAGTCGAGGACGTCTGGGTCACGGTCACGGTCGCGAAGCCACAGCTCCTCC
GAGCCTCGGAAGAATCTGACAGCGAAGACGCCGAGATCCGCGAACGCGAAAGGCCCGACGCGAGCGGCGCAAGGA
AGAAGAGCGCAAACTGCGGCAGAACAGAATGGGCGCAGAGCGGCGGATCCAGGTCATGGCACGAGAGCAGGGACG
CGACATCTCGGAGAAGATTGCGCTGGGGCTGGCGAAGCCGACTCAATCCAAGGAGAGCACGACTCCACGTCTCTT
CAACCGATCAGGGGCTTCGACAGCGGCTTTAACGAGGACAACCATTACGATAAGCCGCTGTTCGCTGCTCAGGAC
GCCATCTCCAGCATCTACCGTCCGCGAGCCAACGTCAATGACGACGGCTTCGACGACGACGCGGGCGACAAGGAG
ATGGCCAAGATTCACAAGATTAGCCGCTTCGGCGAGGCTCTCGGCAAGGGACCTTTCGAGGCGCGGCCGATGCCG
AGGTGAGTTGCTCTTTCCTTGTCTCTTTCGTCCCTTGTCCATCTCTTCAGAGTTCCCTGACAGGCAAACCGTAGG
CACGCGAAGGACCCGTTCAGTTCGAAAAGGCAGCCGATCCTTTCAACGTCGACAAATTCCTGTCCGAGGTGGACC
AGAGCACTTCGTCGAAGCGCGGCTACGGCCTCCAGGCGGATGGCGGAGGAGGAGGTCGGCAGGCGAAACGGGCAC
GGGTCGACGATGACGATGACGAGGGCGGCGGTGGCGGCGAGTGACGACGGGGCCTATCTAGCACGATACGGATGC
AATGAGGCGTTGCTGCGGCTGTTTTCTGTACGAATATCTTTCTTGTCTGCGCATTGCGGGCGTTGGGGGGGATAC
GCTTGTCTTATCCAGCCGCTGGCCCTTTTACAACTGCCACTTCATACTCGCAGCCTCGGCGCTAATCCTCATCCT
TCATTCTCGGCCCGTGTCTCTCTCGCCTCCTAACCCCATGGAACCCCATGGAAGACAAGGAAGCGAGCGACAAGT
GGCAGCATTCCTCCGGACGCCCTCGAAGTTCCTCCGCTTCCGTCTGTTGTTGTCTTTATCCCTTCCAGCATATCG
CTCTTCTGTCCCGTTCTCTGTGTTGCCCGACAAGCCGGCTGGCAAGGCCGCCGACGGATGGGCGGAAGAAAGCAT
TCGACTGTAAAGCTTACTGTCGGCCCGTTCCGCGACGAGAAGCTTCCGCGGTGACAGAAGCGGATAAGGCGAAGG
AACGGAAGGGAAGAGAGGAGGAAACAAGAAGAAGTTTGATCGAAAAGATTAAGGTCTGAAGAAAGGTCATCGGAG
AGTGATTGGCAGGGACGATTGAGGAGACGCTGTCTCGACCTTGGTCATCACCACCCTCCATCACCATCAGCCGAG
AATCGCAACCGAGCCTTGACCAACCAACTATCCATCCGCAACTCCCAACACGAGGTCAAGATGCAGCACGAAGAA
GAAGTCGATCACAAGTCGGGGTCTTCCCCAATACGAGGACATGGACTTTGGCGAGTCACGGACGACGAAGACGGC
GGCTTGGTGGAAGCCGCGGTACTGGCGGAAGCGAACCTGGGCTATTGTCGCGGGCGTCTTCATCGTCATCATTGC
CGTCGTTGTGGCTGTTGCCGTTGCCTTGTCTGGCTTGACGAATTATCCGGATTATAAGGCTGTGTCGTACGCTTT
GCGAGATACCTGTGAGTTGGTGGTGGTTTGCTTGCTTGGATGGCGACTCTGACATTCATCTGATTTAGATGAGGG
GGAAAACTTCTTTGATCAGTTCAATTACTTTACCGGCTGGGATCCCAGTTAGTTTCCCCATGGTTGTCTTGAGGT
TTCCTGGGCTGACGAGGAGGTGCCATTCAGCCAAGGGCTTCGTTCATTATGTTCCACGACCGCAGGCTCAACAGC
TGGTAAGAGACCAGAGATGAAAAGACGCCATGAGAAAAGCTGACGGTCCGATGTAGAACCTAACGTACGCGTCAA
CCAACACAGCCATCGTGAGAGTCGACACCTCAGTCGGTCCCGGATCCAGACCCGATGCCTCAACAGGCCGCTTCT
CCGTAAGACTCGAGTCAAAGAAGACGTACGGAGGCGGCCTCTTCGTCTTCGACGTCAAGCACACGCCTCACGCTT
GCGGCACCTGGCCAGCCCTCTGGCTAACGGACCCATCCCACTGGCCAGACCACGGAGAGATCGACATCATGGAGT
CGATCAACAACGGCGCGGGCGGGAACCAGATGTCGCTGCATACGGCGGATGGGTGTTCCATGGCCGTGACGCGCA
AGATGAAGGGCCACGCGCTGCACAATGACTGCAATCAGGCTAGTAACGGCAACGCCGGCTGTGGCGTCACCGGCG
GGCGCAACTCGTTTGGTCCTGCTCTGAACGCTGCTGGCGGGAGCGTCATGGCGGTTGAGTGGCGAGAAGCCGGCA
TTCGGGTTTGGCAGTTTGGTCGTGGAGATGTGCCGTCTGATGTTGTGGCCAAGAGGCCTAACCCTGCTGGTTGGG
GCACTGCCACGGCTGATTTTCCGAATACTCGCTGTGGCATTGGCTCGATGTTCCGGAACAACTCCATCGTCATCG
ATATCGATCTGTGCGGTGATATGGTATATGGCACCTGGGATCGTTCGTCGTGTGAGTCGTCATCTTTTTCCGTCG
TCATTCTTCTGAGCTGACCCTGGAGTCAGGCCCGAGCACCTGCACTGATCTCGTGTCCAACCAGCCCGCCCTCTT
CAAGACGGCGTACTGGGAGTTTGGCTCCTTTCAAGTCTACCAACCGGCGTCTCCGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail