Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06451
Gene name
Locationscaffold_08:5100..6227
Strand+
Gene length (bp)1127
Transcript length (bp)717
Coding sequence length (bp)717
Protein length (aa) 239

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01105 EMP24_GP25L emp24/gp25L/p24 family/GOLD 4.2E-48 49 231

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.5

Transmembrane Domains

Domain # Start End Length
1 204 226 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.08 0.0 0.28
Alive In ants, during behavior modification 0.00 0.0 0.00
Dead In ants, recently dead 0.02 0.0 0.22

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 1.0 no
Alive Dead 1.0 no
Dead Fungus 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06451
MRRVLCSRVTSPKGCSPDTAGLIVRVRNGLPTIAAGVFACLVTNVVATALTYKLEAGEKACFYAETNKENEKIAF
YFAVQSGGSFDIDYRVEGPDSKIILEGEKERQGDFVFSAQKTGEYSFCFDNEMSTFTEKMIDIEISSEHEARTAQ
LPSKQGTSPEQTSVLEESIFKISGQLSTISRNQKYFRTRENRNFSTVNSTEKRIVNFSVIQICLIVCMGALQVLV
VRFFFQGARKGYV*
Coding >Ophcf2|06451
ATGAGACGCGTATTATGCTCAAGGGTCACGTCACCTAAAGGTTGCTCCCCAGACACTGCAGGCCTTATTGTCCGC
GTTCGCAATGGACTGCCAACCATCGCAGCGGGCGTCTTTGCCTGTTTAGTCACCAATGTCGTCGCCACGGCGCTG
ACGTACAAGCTGGAAGCGGGCGAGAAGGCCTGCTTCTACGCCGAGACCAACAAGGAGAACGAGAAGATTGCGTTT
TATTTTGCCGTCCAATCTGGAGGCTCTTTCGATATCGACTACCGTGTTGAGGGCCCGGACTCGAAGATTATCCTC
GAGGGCGAGAAGGAGCGTCAAGGCGACTTCGTCTTCTCGGCTCAAAAGACGGGCGAATACTCTTTTTGTTTCGAC
AACGAGATGAGCACCTTTACGGAGAAGATGATCGATATCGAGATCTCAAGCGAGCACGAAGCCCGCACAGCCCAG
CTTCCATCCAAGCAGGGAACATCTCCCGAGCAAACGTCGGTCCTGGAGGAGTCGATATTCAAGATCTCAGGTCAA
CTATCTACCATCTCGCGCAACCAGAAATACTTTCGAACTCGGGAAAACCGCAACTTTAGCACCGTCAACAGCACA
GAGAAACGGATTGTCAACTTTAGCGTGATTCAGATTTGCCTTATCGTCTGCATGGGCGCCCTTCAGGTGTTGGTC
GTCAGGTTCTTCTTCCAGGGAGCACGCAAAGGCTATGTATGA
Transcript >Ophcf2|06451
ATGAGACGCGTATTATGCTCAAGGGTCACGTCACCTAAAGGTTGCTCCCCAGACACTGCAGGCCTTATTGTCCGC
GTTCGCAATGGACTGCCAACCATCGCAGCGGGCGTCTTTGCCTGTTTAGTCACCAATGTCGTCGCCACGGCGCTG
ACGTACAAGCTGGAAGCGGGCGAGAAGGCCTGCTTCTACGCCGAGACCAACAAGGAGAACGAGAAGATTGCGTTT
TATTTTGCCGTCCAATCTGGAGGCTCTTTCGATATCGACTACCGTGTTGAGGGCCCGGACTCGAAGATTATCCTC
GAGGGCGAGAAGGAGCGTCAAGGCGACTTCGTCTTCTCGGCTCAAAAGACGGGCGAATACTCTTTTTGTTTCGAC
AACGAGATGAGCACCTTTACGGAGAAGATGATCGATATCGAGATCTCAAGCGAGCACGAAGCCCGCACAGCCCAG
CTTCCATCCAAGCAGGGAACATCTCCCGAGCAAACGTCGGTCCTGGAGGAGTCGATATTCAAGATCTCAGGTCAA
CTATCTACCATCTCGCGCAACCAGAAATACTTTCGAACTCGGGAAAACCGCAACTTTAGCACCGTCAACAGCACA
GAGAAACGGATTGTCAACTTTAGCGTGATTCAGATTTGCCTTATCGTCTGCATGGGCGCCCTTCAGGTGTTGGTC
GTCAGGTTCTTCTTCCAGGGAGCACGCAAAGGCTATGTATGA
Gene >Ophcf2|06451
ATGAGACGCGTATTATGCTCAAGGGTCACGTCACCTAAAGGTTGCTCCCCAGACACTGCAGGGTAAGCTGCGGCG
CGAAGGTGTGGCTAGTACAAGGTAAAGCTGTCAGCCTGTCACCCGTGGCCCGTGGGCCGTGGCCCGTGGGCCGTG
GTGCCGGTCGGTAAGGGGTCGGCGCTAAGAAAATTCCGAGCCGAAGCCATGTAATCGTGGCCTCAGTACTACAGT
AGGTAGAGGCTAATCGACCTGGCTGAGTTTGGTCGTGTCTCCATCGCCTTCGACTGGCGACAAACCTCAGCCTTA
TTGTCCGCGTTCGCAATGGACTGCCAACCATCGCAGCGGGCGTCTTTGCCTGTTTAGTCACCAATGTCGTCGCCA
CGGCGCTGACGTACAAGCTGGAAGCGGGCGAGAAGGCCTGCTTCTACGCCGAGACCAACAAGGAGAACGAGAAGA
TTGCGTTTTATTTTGCCGTAGGCTTTCTTCGCTGAGGCATCTGGGTCTTCTGTGCTTATTCTGACCGCATCATAG
GTCCAATCTGGAGGCTCTTTCGATATCGACTACCGTGTTGAGGGCCCGGACTCGAAGATTATCCTCGAGGGCGAG
AAGGAGCGTCAAGGCGACTTCGTCTTCTCGGCTCAAAAGACGGGCGAATACTCTTTTTGTTTCGACAACGAGATG
AGCACCTTTACGGAGAAGATGATCGATATCGAGATCTCAGTCTGTTCACCCAGCGGCCCTACCGTCATACACAGG
CATGCTGATTCTTTCATGGTGCAGAGCGAGCACGAAGCCCGCACAGCCCAGCTTCCATCCAAGCAGGGAACATCT
CCCGAGCAAACGTCGGTCCTGGAGGAGTCGATATTCAAGATCTCAGGTCAACTATCTACCATCTCGCGCAACCAG
AAATACTTTCGAACTCGGGAAAACCGCAACTTTAGCACCGTCAACAGCACAGAGAAACGGATTGTCAACTTTAGC
GTGATTCAGATTTGCCTTATCGTCTGCATGGGCGCCCTTCAGGTGTTGGTCGTCAGGTTCTTCTTCCAGGTATGT
CCATAAGCCTATGATGATCGAGAGTAGTATCTGACAGCCTTTGCCAAACTCAGGGAGCACGCAAAGGCTATGTAT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail