Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06438
Gene name
Locationscaffold_07:2432646..2435218
Strand+
Gene length (bp)2572
Transcript length (bp)2394
Coding sequence length (bp)2394
Protein length (aa) 798

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.6E-170 101 750

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:1904680 peptide transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 103 125 22
2 130 152 22
3 176 198 22
4 210 229 19
5 233 255 22
6 276 307 31
7 322 344 22
8 349 371 22
9 423 445 22
10 475 497 22
11 501 523 22
12 549 571 22
13 586 608 22
14 653 675 22
15 701 720 19
16 733 755 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 158.98 79.74 238.21
Alive In ants, during behavior modification 785.72 239.42 1332.01
Dead In ants, recently dead 755.78 270.85 1240.72

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.903258 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06438
MGLKDRFGVRAREMGGETSGAEIRPEVSADHNPDRELRRFRNQHKWDPFLDIDKLDNIDEALASGNADKEAAVDE
SLIQEDSPYPEVRSSVPPHDIDMPVNTIRAWVIGGVLCTIVAACNILLNLRRTPISITSTVVQLVAYPIGVGWAR
VMPDVSFTLFGHTLSLNPGPFNVKEHTLITMMTAAGSSISYSIDILLAQEIFYKQEFKWGFQILLMLSTQAMGFG
IAGVARRFLVWPSSMVWPATLITCSVMYSLHDHRPSDPAETNGWRIGRYRFFLYVALATFAWEWFPLVIAPFLSL
FMFATWIAPTNVIVNQIFGGQSGLGLLPISFDWSVITAFLLSPLQTPAFAIFNVFAGIMLTTIGAIGLAWAGPEY
YRYLPLSANQNFDRFAKPYNTSRILTPDFVINETAYQAYSPILLGPTFSLSYGLSFATLISTITHVALFYGHDVW
NRARDSKYEEPDVHLKLMRKYRECPEWWFMSIFAVSFAFGMIASQFWKTNLTWWAYIVCILIGVVLFIPIGMVQA
ITNQQTGLNVITEMIIGYMMPGRPVAMMLFKSWGYMLSYNGLTYISDMKVGHYMKIPPRSMFAAQAFAVIWLSFV
QISTYNFLRGNIEGICTPTQAQGLTCPNAKTFYNASVIWGVIGPRKVFGAGSIYAWTNWFWFIGFAVPLIQWFAA
RRWPRSWVRYLVSPALFGAAGMMPPATLFYLFQWVIVGLLFNFFIRRRFFGWWTRYNYPLSGALDIGTALCTVVA
GLGLGLSETQFPTWWGTTVAGNTLDANNTAVTKVFVEGQQPIGPSSW*
Coding >Ophcf2|06438
ATGGGCCTCAAGGACCGCTTCGGCGTCCGGGCGAGGGAGATGGGCGGCGAAACGTCTGGCGCCGAGATCCGGCCT
GAGGTCTCGGCCGACCATAACCCGGATCGCGAGCTGCGTCGCTTCAGAAATCAGCACAAGTGGGATCCCTTCCTC
GACATCGACAAGCTTGACAACATCGACGAGGCTCTCGCTTCGGGCAATGCCGACAAGGAGGCGGCTGTCGACGAG
TCTCTGATCCAGGAAGACTCGCCGTACCCGGAAGTGCGGTCGTCGGTCCCTCCTCATGACATTGACATGCCCGTT
AACACGATCCGCGCCTGGGTCATCGGCGGTGTGCTCTGCACCATCGTGGCCGCCTGCAACATCCTGCTCAACCTG
CGGCGGACGCCCATCTCCATCACCTCGACAGTGGTGCAGCTGGTGGCCTACCCCATCGGTGTTGGCTGGGCCCGC
GTCATGCCCGACGTCTCCTTCACCCTCTTCGGTCACACGTTGTCCCTCAACCCCGGCCCCTTCAACGTCAAGGAG
CACACGCTCATCACTATGATGACGGCCGCCGGCTCCAGCATTAGCTACTCCATCGACATCCTACTCGCCCAGGAA
ATCTTCTACAAGCAAGAGTTCAAATGGGGCTTCCAGATCCTGCTCATGCTCTCCACCCAGGCCATGGGCTTCGGC
ATCGCCGGTGTCGCCCGCCGCTTCCTTGTCTGGCCCTCGTCCATGGTCTGGCCCGCAACGCTCATCACCTGCTCC
GTCATGTACTCGCTGCATGACCACCGGCCCTCGGACCCGGCAGAGACCAATGGCTGGCGCATTGGCCGCTACAGG
TTCTTCCTCTACGTCGCCCTCGCCACCTTTGCCTGGGAATGGTTCCCCCTCGTCATCGCCCCCTTCTTGTCGCTC
TTCATGTTCGCCACCTGGATCGCGCCCACAAACGTCATCGTCAACCAGATCTTCGGCGGACAATCGGGTCTCGGC
CTGCTGCCCATCTCGTTCGATTGGTCCGTCATCACCGCCTTCCTGTTGTCGCCTCTGCAGACGCCCGCCTTTGCC
ATCTTCAACGTCTTCGCCGGCATCATGCTCACCACCATCGGCGCCATTGGCCTCGCCTGGGCCGGGCCCGAGTAC
TACCGCTACCTGCCGCTCAGCGCCAACCAGAACTTTGACCGCTTCGCCAAGCCCTACAACACCAGCCGCATCCTG
ACGCCCGACTTCGTCATCAACGAGACGGCCTACCAGGCCTACTCACCCATCCTGCTGGGGCCGACCTTTTCCCTC
TCGTACGGCTTGTCCTTTGCCACGCTCATCTCTACAATCACCCACGTCGCCCTCTTCTACGGTCACGACGTCTGG
AACCGCGCGCGCGACTCCAAGTACGAGGAGCCAGATGTGCACCTCAAGCTGATGCGCAAGTACCGCGAGTGCCCC
GAGTGGTGGTTCATGTCCATCTTCGCCGTTAGCTTCGCCTTTGGCATGATTGCCAGCCAGTTCTGGAAGACCAAC
CTCACCTGGTGGGCCTACATCGTCTGCATCCTCATCGGCGTCGTCCTCTTCATCCCCATCGGCATGGTTCAGGCC
ATCACAAACCAGCAGACGGGCCTCAACGTCATCACCGAGATGATTATTGGCTACATGATGCCTGGCCGCCCAGTC
GCCATGATGCTCTTCAAGTCGTGGGGCTACATGCTGTCCTACAACGGCCTGACGTACATCTCCGACATGAAGGTC
GGCCACTACATGAAGATTCCACCCCGGAGCATGTTCGCCGCCCAGGCCTTTGCCGTCATCTGGCTGTCCTTTGTC
CAGATCTCCACCTACAACTTCTTGCGCGGCAACATCGAGGGCATCTGCACCCCGACGCAGGCCCAGGGCCTGACG
TGCCCCAACGCCAAGACGTTTTACAACGCCAGCGTCATCTGGGGCGTCATCGGGCCCCGTAAGGTCTTCGGCGCC
GGCAGCATCTACGCCTGGACCAACTGGTTCTGGTTCATCGGCTTCGCCGTGCCCCTCATCCAATGGTTCGCCGCC
CGCCGCTGGCCCCGGTCCTGGGTCCGCTACCTCGTCTCGCCCGCCCTGTTCGGCGCCGCCGGCATGATGCCGCCC
GCCACGCTCTTCTACCTGTTCCAGTGGGTCATTGTCGGCCTCCTATTTAACTTTTTCATCCGCAGACGCTTCTTC
GGCTGGTGGACTCGCTACAACTACCCCCTCTCCGGCGCCCTCGACATCGGCACCGCCCTGTGTACCGTCGTCGCC
GGCCTCGGCTTGGGTCTCAGCGAGACGCAGTTCCCAACGTGGTGGGGGACCACCGTCGCCGGCAACACTCTCGAC
GCCAACAACACGGCCGTCACAAAGGTCTTTGTGGAGGGGCAGCAGCCCATCGGGCCGTCGAGCTGGTAG
Transcript >Ophcf2|06438
ATGGGCCTCAAGGACCGCTTCGGCGTCCGGGCGAGGGAGATGGGCGGCGAAACGTCTGGCGCCGAGATCCGGCCT
GAGGTCTCGGCCGACCATAACCCGGATCGCGAGCTGCGTCGCTTCAGAAATCAGCACAAGTGGGATCCCTTCCTC
GACATCGACAAGCTTGACAACATCGACGAGGCTCTCGCTTCGGGCAATGCCGACAAGGAGGCGGCTGTCGACGAG
TCTCTGATCCAGGAAGACTCGCCGTACCCGGAAGTGCGGTCGTCGGTCCCTCCTCATGACATTGACATGCCCGTT
AACACGATCCGCGCCTGGGTCATCGGCGGTGTGCTCTGCACCATCGTGGCCGCCTGCAACATCCTGCTCAACCTG
CGGCGGACGCCCATCTCCATCACCTCGACAGTGGTGCAGCTGGTGGCCTACCCCATCGGTGTTGGCTGGGCCCGC
GTCATGCCCGACGTCTCCTTCACCCTCTTCGGTCACACGTTGTCCCTCAACCCCGGCCCCTTCAACGTCAAGGAG
CACACGCTCATCACTATGATGACGGCCGCCGGCTCCAGCATTAGCTACTCCATCGACATCCTACTCGCCCAGGAA
ATCTTCTACAAGCAAGAGTTCAAATGGGGCTTCCAGATCCTGCTCATGCTCTCCACCCAGGCCATGGGCTTCGGC
ATCGCCGGTGTCGCCCGCCGCTTCCTTGTCTGGCCCTCGTCCATGGTCTGGCCCGCAACGCTCATCACCTGCTCC
GTCATGTACTCGCTGCATGACCACCGGCCCTCGGACCCGGCAGAGACCAATGGCTGGCGCATTGGCCGCTACAGG
TTCTTCCTCTACGTCGCCCTCGCCACCTTTGCCTGGGAATGGTTCCCCCTCGTCATCGCCCCCTTCTTGTCGCTC
TTCATGTTCGCCACCTGGATCGCGCCCACAAACGTCATCGTCAACCAGATCTTCGGCGGACAATCGGGTCTCGGC
CTGCTGCCCATCTCGTTCGATTGGTCCGTCATCACCGCCTTCCTGTTGTCGCCTCTGCAGACGCCCGCCTTTGCC
ATCTTCAACGTCTTCGCCGGCATCATGCTCACCACCATCGGCGCCATTGGCCTCGCCTGGGCCGGGCCCGAGTAC
TACCGCTACCTGCCGCTCAGCGCCAACCAGAACTTTGACCGCTTCGCCAAGCCCTACAACACCAGCCGCATCCTG
ACGCCCGACTTCGTCATCAACGAGACGGCCTACCAGGCCTACTCACCCATCCTGCTGGGGCCGACCTTTTCCCTC
TCGTACGGCTTGTCCTTTGCCACGCTCATCTCTACAATCACCCACGTCGCCCTCTTCTACGGTCACGACGTCTGG
AACCGCGCGCGCGACTCCAAGTACGAGGAGCCAGATGTGCACCTCAAGCTGATGCGCAAGTACCGCGAGTGCCCC
GAGTGGTGGTTCATGTCCATCTTCGCCGTTAGCTTCGCCTTTGGCATGATTGCCAGCCAGTTCTGGAAGACCAAC
CTCACCTGGTGGGCCTACATCGTCTGCATCCTCATCGGCGTCGTCCTCTTCATCCCCATCGGCATGGTTCAGGCC
ATCACAAACCAGCAGACGGGCCTCAACGTCATCACCGAGATGATTATTGGCTACATGATGCCTGGCCGCCCAGTC
GCCATGATGCTCTTCAAGTCGTGGGGCTACATGCTGTCCTACAACGGCCTGACGTACATCTCCGACATGAAGGTC
GGCCACTACATGAAGATTCCACCCCGGAGCATGTTCGCCGCCCAGGCCTTTGCCGTCATCTGGCTGTCCTTTGTC
CAGATCTCCACCTACAACTTCTTGCGCGGCAACATCGAGGGCATCTGCACCCCGACGCAGGCCCAGGGCCTGACG
TGCCCCAACGCCAAGACGTTTTACAACGCCAGCGTCATCTGGGGCGTCATCGGGCCCCGTAAGGTCTTCGGCGCC
GGCAGCATCTACGCCTGGACCAACTGGTTCTGGTTCATCGGCTTCGCCGTGCCCCTCATCCAATGGTTCGCCGCC
CGCCGCTGGCCCCGGTCCTGGGTCCGCTACCTCGTCTCGCCCGCCCTGTTCGGCGCCGCCGGCATGATGCCGCCC
GCCACGCTCTTCTACCTGTTCCAGTGGGTCATTGTCGGCCTCCTATTTAACTTTTTCATCCGCAGACGCTTCTTC
GGCTGGTGGACTCGCTACAACTACCCCCTCTCCGGCGCCCTCGACATCGGCACCGCCCTGTGTACCGTCGTCGCC
GGCCTCGGCTTGGGTCTCAGCGAGACGCAGTTCCCAACGTGGTGGGGGACCACCGTCGCCGGCAACACTCTCGAC
GCCAACAACACGGCCGTCACAAAGGTCTTTGTGGAGGGGCAGCAGCCCATCGGGCCGTCGAGCTGGTAG
Gene >Ophcf2|06438
ATGGGCCTCAAGGACCGCTTCGGCGTCCGGGCGAGGGAGATGGGCGGCGAAACGTCTGGCGCCGAGATCCGGCCT
GAGGTCTCGGCCGACCATAACCCGGATCGCGAGCTGCGTCGCTTCAGAAATCAGCACAAGTGGGATCCCTTCCTC
GACATCGACAAGCTTGACAACATCGACGAGGCTCTCGCTTCGGGCAATGCCGACAAGGAGGCGGCTGTCGACGAG
TCTCTGATCCAGGAAGACTCGCCGTACCCGGAAGTGCGGTCGTCGGTGAGTCTGCTGGATAGAGCTGGGTATCTT
CAAGTTAGCTGACGGCTCAGGTCCCTCCTCATGACATTGACATGCCCGTTAACACGATCCGCGCCTGGGTCATCG
GCGGTGTGCTCTGCACCATCGTGGCCGCCTGCAACATCCTGCTCAACCTGCGGCGGACGCCCATCTCCATCACCT
CGACAGTGGTGCAGCTGGTGGCCTACCCGTGAGATCTCTTGACCTCCCTGGCATGCCTATCCTCTCGTCTGACTT
GTCCAGCATCGGTGTTGGCTGGGCCCGCGTCATGCCCGACGTCTCCTTCACCCTCTTCGGTCACACGTTGTCCCT
CAACCCCGGCCCCTTCAACGTCAAGGAGCACACGCTCATCACTATGATGACGGCCGCCGGCTCCAGCATTAGCTA
CTCCATCGACATCCTACTCGCCCAGGAAATCTTCTACAAGCAAGAGTTCAAATGGGGCTTCCAGATCCTGCTCAT
GCTCTCCACCCAGGCCATGGGCTTCGGCATCGCCGGTGTCGCCCGCCGCTTCCTTGTCTGGCCCTCGTCCATGGT
CTGGCCCGCAACGCTCATCACCTGCTCCGTCATGTACTCGCTGCATGACCACCGGCCCTCGGACCCGGCAGAGAC
CAATGGCTGGCGCATTGGCCGCTACAGGTTCTTCCTCTACGTCGCCCTCGCCACCTTTGCCTGGGAATGGTTCCC
CCTCGTCATCGCCCCCTTCTTGTCGCTCTTCATGTTCGCCACCTGGATCGCGCCCACAAACGTCATCGTCAACCA
GATCTTCGGCGGACAATCGGGTCTCGGCCTGCTGCCCATCTCGTTCGATTGGTCCGTCATCACCGCCTTCCTGTT
GTCGCCTCTGCAGACGCCCGCCTTTGCCATCTTCAACGTCTTCGCCGGCATCATGCTCACCACCATCGGCGCCAT
TGGCCTCGCCTGGGCCGGGCCCGAGTACTACCGCTACCTGCCGCTCAGCGCCAACCAGAACTTTGACCGCTTCGC
CAAGCCCTACAACACCAGCCGCATCCTGACGCCCGACTTCGTCATCAACGAGACGGCCTACCAGGCCTACTCACC
CATCCTGCTGGGGCCGACCTTTTCCCTCTCGTACGGCTTGTCCTTTGCCACGCTCATCTCTACAATCACCCACGT
CGCCCTCTTCTACGGTCACGACGTCTGGAACCGCGCGCGCGACTCCAAGTACGAGGAGCCAGATGTGCACCTCAA
GCTGATGCGCAAGTACCGCGAGTGCCCCGAGTGGTGGTTCATGTCCATCTTCGCCGTTAGCTTCGCCTTTGGCAT
GATTGCCAGCCAGTTCTGGAAGACCAACCTCACCTGGTGGGCCTACATCGTCTGCATCCTCATCGGCGTCGTCCT
CTTCATCCCCATCGGCATGGTTCAGGCCATCACAAACCAGCAGACGGGCCTCAACGTCATCACCGAGATGATTAT
TGGCTACATGATGCCTGGCCGCCCAGTCGCCATGATGCTCTTCAAGTCGTGGGGCTACATGCTGTCCTACAACGG
CCTGACGTACATCTCCGACATGAAGGTCGGCCACTACATGAAGATTCCACCCCGGAGCATGTTCGCCGCCCAGGC
CTTTGCCGTCATCTGGCTGTCCTTTGTCCAGATCTCCACCTACAACTTCTTGCGCGGCAACATCGAGGGCATCTG
CACCCCGACGCAGGCCCAGGGCCTGACGTGCCCCAACGCCAAGACGTTTTACAACGCCAGCGTCATCTGGGGCGT
CATCGGGCCCCGTAAGGTCTTCGGCGCCGGCAGCATCTACGCCTGGACCAACTGGTTCTGGTTCATCGGCTTCGC
CGTGCCCCTCATCCAATGGTTCGCCGCCCGCCGCTGGCCCCGGTCCTGGGTCCGCTACCTCGTCTCGCCCGCCCT
GTTCGGCGCCGCCGGCATGATGCCGCCCGCCACGCTCTTCTACCTGTTCCAGTGGGTCATTGTCGGCCTCCTATT
TAACTTTTTCATCCGCAGACGCTTCTTCGGCTGGTGGAGTAAGCTGCTTCTTCTCCCTTTCTCCTTTACTCTGAT
GTCGTTGTTTCTGTTTTTTTCTGACGCTTTTCCTTTAGCTCGCTACAACTACCCCCTCTCCGGCGCCCTCGACAT
CGGCACCGCCCTGTGTACCGTCGTCGCCGGCCTCGGCTTGGGTCTCAGCGAGACGCAGTTCCCAACGTGGTGGGG
GACCACCGTCGCCGGCAACACTCTCGACGCCAACAACACGGCCGTCACAAAGGTCTTTGTGGAGGGGCAGCAGCC
CATCGGGCCGTCGAGCTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail