Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06430
Gene name
Locationscaffold_07:2411684..2412494
Strand+
Gene length (bp)810
Transcript length (bp)681
Coding sequence length (bp)681
Protein length (aa) 227

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06703 SPC25 Microsomal signal peptidase 25 kDa subunit (SPC25) 3.3E-49 14 166

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006465 signal peptide processing Yes
GO:0005787 signal peptidase complex Yes
GO:0019538 protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0110165 cellular anatomical entity No
GO:1905368 peptidase complex No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0043170 macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0051604 protein maturation No
GO:0016485 protein processing No
GO:0006518 peptide metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0098796 membrane protein complex No
GO:0008150 biological_process No
GO:0006508 proteolysis No
GO:1902494 catalytic complex No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 41 63 22
2 73 90 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 305.29 173.57 437.02
Alive In ants, during behavior modification 333.81 185.34 482.28
Dead In ants, recently dead 231.18 130.95 331.41

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.692649 no
Alive Dead 0.021927 yes
Dead Fungus 0.143723 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06430
MAASEKISVYNLADLKNTSDDAIPNYLNSLRFKQSHFLTDVRLALGYGAFAIAAAAFLWDYRIGFDATKVYTAVA
VAIYAVVNTTLTFWITRVEKGIVYQGVSPDGEELSIATTVTKNDPTYRLTVTIKPRDSAPQVIKFTAPFATFFDE
TGRFVAKPFQELLASSVPLIRKFDPKRATSNKIASQDLLDADPDLLDAVLAADPAKVTTSTASDAKSGGKRRKSA
K*
Coding >Ophcf2|06430
ATGGCCGCCTCCGAGAAGATCAGCGTCTACAATCTCGCTGACCTCAAGAACACGTCTGACGACGCCATCCCCAAC
TACCTCAACTCCCTCCGCTTCAAGCAATCCCACTTCCTAACGGATGTCCGTCTCGCCCTCGGCTACGGCGCTTTT
GCCATTGCGGCAGCTGCCTTTCTATGGGACTACCGTATCGGCTTCGACGCTACCAAGGTGTACACGGCCGTCGCC
GTCGCCATCTATGCCGTCGTCAACACCACCCTGACCTTCTGGATTACCCGCGTCGAAAAGGGCATCGTCTACCAG
GGTGTCTCTCCTGACGGCGAAGAGCTCTCCATCGCGACAACCGTCACCAAAAATGACCCAACCTACCGCCTCACC
GTCACCATCAAACCCCGCGACTCCGCACCGCAAGTCATCAAATTCACCGCCCCCTTCGCCACATTTTTCGACGAG
ACTGGCCGCTTCGTCGCCAAGCCCTTCCAGGAGCTGCTCGCCTCGTCCGTGCCCCTCATCCGCAAGTTCGATCCC
AAGCGCGCAACCAGCAACAAGATTGCTTCTCAGGACCTGCTTGATGCCGACCCCGATCTTCTGGATGCCGTCTTG
GCTGCTGATCCGGCCAAGGTCACCACCTCGACTGCTTCTGATGCTAAATCCGGCGGCAAGAGACGCAAGTCGGCC
AAATAA
Transcript >Ophcf2|06430
ATGGCCGCCTCCGAGAAGATCAGCGTCTACAATCTCGCTGACCTCAAGAACACGTCTGACGACGCCATCCCCAAC
TACCTCAACTCCCTCCGCTTCAAGCAATCCCACTTCCTAACGGATGTCCGTCTCGCCCTCGGCTACGGCGCTTTT
GCCATTGCGGCAGCTGCCTTTCTATGGGACTACCGTATCGGCTTCGACGCTACCAAGGTGTACACGGCCGTCGCC
GTCGCCATCTATGCCGTCGTCAACACCACCCTGACCTTCTGGATTACCCGCGTCGAAAAGGGCATCGTCTACCAG
GGTGTCTCTCCTGACGGCGAAGAGCTCTCCATCGCGACAACCGTCACCAAAAATGACCCAACCTACCGCCTCACC
GTCACCATCAAACCCCGCGACTCCGCACCGCAAGTCATCAAATTCACCGCCCCCTTCGCCACATTTTTCGACGAG
ACTGGCCGCTTCGTCGCCAAGCCCTTCCAGGAGCTGCTCGCCTCGTCCGTGCCCCTCATCCGCAAGTTCGATCCC
AAGCGCGCAACCAGCAACAAGATTGCTTCTCAGGACCTGCTTGATGCCGACCCCGATCTTCTGGATGCCGTCTTG
GCTGCTGATCCGGCCAAGGTCACCACCTCGACTGCTTCTGATGCTAAATCCGGCGGCAAGAGACGCAAGTCGGCC
AAATAA
Gene >Ophcf2|06430
ATGGCCGCCTCCGAGAAGATCAGCGTCTACAATCTCGCTGGTGGGCCTCTCTCTTCTTTCCAAGCCCACCAACTC
AATCTCTCTTCCACAGACTAACCCTTTCCAGACCTCAAGAACACGTCTGACGACGCCATCCCCAACTACCTCAAC
TCCCTCCGCTTCAAGCAATCCCACTTCCTAACGGATGTCCGTCTCGCCCTCGGCTACGGCGCTTTTGCCATTGCG
GCAGCTGCCTTTCTATGGGACTACCGTATCGGCTTCGACGCTACCAAGGTGTACACGGCCGTCGCCGTCGCCATC
TATGCCGTCGTCAACACCACCCTGACCTTCTGGATTACCCGCGTCGAAAAGGGCATCGTCTACCAGGGTGTCTCT
CCTGACGGCGAAGAGGTATCAAATCTCCTCGCTCTCCATGCATTTCTCATCGTGAGCCAGTGACTGATCCCTCCC
CAGCTCTCCATCGCGACAACCGTCACCAAAAATGACCCAACCTACCGCCTCACCGTCACCATCAAACCCCGCGAC
TCCGCACCGCAAGTCATCAAATTCACCGCCCCCTTCGCCACATTTTTCGACGAGACTGGCCGCTTCGTCGCCAAG
CCCTTCCAGGAGCTGCTCGCCTCGTCCGTGCCCCTCATCCGCAAGTTCGATCCCAAGCGCGCAACCAGCAACAAG
ATTGCTTCTCAGGACCTGCTTGATGCCGACCCCGATCTTCTGGATGCCGTCTTGGCTGCTGATCCGGCCAAGGTC
ACCACCTCGACTGCTTCTGATGCTAAATCCGGCGGCAAGAGACGCAAGTCGGCCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail