Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06428
Gene name
Locationscaffold_07:2407842..2408382
Strand-
Gene length (bp)540
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05970 PIF1 PIF1-like helicase 6.1E-15 55 177
PF13604 AAA_30 AAA domain 1.9E-11 57 172
PF13245 AAA_19 AAA domain 8.0E-10 59 168

GO

GO Term Description Terminal node
GO:0000723 telomere maintenance Yes
GO:0006281 DNA repair Yes
GO:0003678 DNA helicase activity Yes
GO:0071840 cellular component organization or biogenesis No
GO:0140097 catalytic activity, acting on DNA No
GO:0003824 catalytic activity No
GO:0006996 organelle organization No
GO:0043170 macromolecule metabolic process No
GO:0006259 DNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0051716 cellular response to stimulus No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0050896 response to stimulus No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:0004386 helicase activity No
GO:0032200 telomere organization No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0016043 cellular component organization No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0006950 response to stress No
GO:0051276 chromosome organization No
GO:0006974 cellular response to DNA damage stimulus No
GO:1901360 organic cyclic compound metabolic process No
GO:0003674 molecular_function No
GO:0140657 ATP-dependent activity No
GO:0006807 nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4342 0.8263 0.1072 0.1066 0.2869 0.009 0.0988 0.2571 0.0592 0.0185

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3397
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06426
Ophiocordyceps camponoti-floridani Ophcf2|06428 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1493
Ophiocordyceps kimflemingae Ophio5|7522
Ophiocordyceps kimflemingae Ophio5|8560
Ophiocordyceps subramaniannii Hirsu2|6356

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06428
MSQESTTTADTRDGNPQPLFWYQTTGGDSPSPLVRQQSDSSTDTIQPSTSTEPKLCGEQQYIVDLIARGRNVFFT
GSAGCGKSTVLKAALNRLREESPLSNVCVLAPTGHAALQINGMTTWSYMGWTPDYHKLPIEELKNQGWRRHVQDR
LRKTDILVINEISMIENHYFERINVCMCR*
Coding >Ophcf2|06428
ATGAGCCAAGAGTCGACAACGACGGCGGACACGCGTGATGGGAACCCGCAGCCGCTGTTCTGGTATCAAACTACC
GGTGGAGATTCCCCGTCGCCGCTCGTACGCCAACAGAGCGATTCGTCGACGGACACTATTCAGCCGTCGACATCG
ACGGAACCGAAGCTCTGCGGAGAACAGCAGTATATTGTCGATCTTATTGCCAGAGGCCGCAACGTATTTTTTACT
GGCTCCGCTGGGTGCGGAAAGTCGACCGTCTTGAAGGCTGCCCTGAACAGACTGCGAGAGGAGTCTCCCCTGTCG
AACGTCTGCGTATTGGCTCCGACGGGACACGCGGCGTTGCAGATCAACGGCATGACGACGTGGTCCTACATGGGA
TGGACTCCCGACTATCATAAGCTTCCGATTGAAGAGTTAAAGAACCAAGGCTGGCGGCGCCATGTTCAAGACCGT
CTCCGGAAAACAGATATTCTCGTGATTAACGAAATAAGCATGATCGAGAACCACTACTTTGAAAGGATTAACGTG
TGCATGTGTCGGTAG
Transcript >Ophcf2|06428
ATGAGCCAAGAGTCGACAACGACGGCGGACACGCGTGATGGGAACCCGCAGCCGCTGTTCTGGTATCAAACTACC
GGTGGAGATTCCCCGTCGCCGCTCGTACGCCAACAGAGCGATTCGTCGACGGACACTATTCAGCCGTCGACATCG
ACGGAACCGAAGCTCTGCGGAGAACAGCAGTATATTGTCGATCTTATTGCCAGAGGCCGCAACGTATTTTTTACT
GGCTCCGCTGGGTGCGGAAAGTCGACCGTCTTGAAGGCTGCCCTGAACAGACTGCGAGAGGAGTCTCCCCTGTCG
AACGTCTGCGTATTGGCTCCGACGGGACACGCGGCGTTGCAGATCAACGGCATGACGACGTGGTCCTACATGGGA
TGGACTCCCGACTATCATAAGCTTCCGATTGAAGAGTTAAAGAACCAAGGCTGGCGGCGCCATGTTCAAGACCGT
CTCCGGAAAACAGATATTCTCGTGATTAACGAAATAAGCATGATCGAGAACCACTACTTTGAAAGGATTAACGTG
TGCATGTGTCGGTAG
Gene >Ophcf2|06428
ATGAGCCAAGAGTCGACAACGACGGCGGACACGCGTGATGGGAACCCGCAGCCGCTGTTCTGGTATCAAACTACC
GGTGGAGATTCCCCGTCGCCGCTCGTACGCCAACAGAGCGATTCGTCGACGGACACTATTCAGCCGTCGACATCG
ACGGAACCGAAGCTCTGCGGAGAACAGCAGTATATTGTCGATCTTATTGCCAGAGGCCGCAACGTATTTTTTACT
GGCTCCGCTGGGTGCGGAAAGTCGACCGTCTTGAAGGCTGCCCTGAACAGACTGCGAGAGGAGTCTCCCCTGTCG
AACGTCTGCGTATTGGCTCCGACGGGACACGCGGCGTTGCAGATCAACGGCATGACGACGTGGTCCTACATGGGA
TGGACTCCCGACTATCATAAGCTTCCGATTGAAGAGTTAAAGAACCAAGGCTGGCGGCGCCATGTTCAAGACCGT
CTCCGGAAAACAGATATTCTCGTGATTAACGAAATAAGCATGATCGAGAACCACTACTTTGAAAGGATTAACGTG
TGCATGTGTCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail