Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06425
Gene name
Locationscaffold_07:2342510..2345446
Strand-
Gene length (bp)2936
Transcript length (bp)2634
Coding sequence length (bp)2634
Protein length (aa) 878

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03707 MHYT Bacterial signalling protein N terminal repeat 1.4E-08 71 126

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 59 81 22
3 101 121 20
4 128 150 22
5 165 187 22
6 242 264 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06425
MQLQMASPQELFLQYEGKLVPHDYEAGLVVVSVIICFVGTSSALELIRRQTSNKGLHNLLLLAGAAICMGGIAMW
SMHYIGNRSVRFLDGQREFQFVYKTGLAVVALLIPIIVLFVAFIIITRHGRVCWVRITLAGFISGATLVGMHYLV
DASIDNYKPVYHVGNIVGAALIGVFTNIGALAFLFVFESAWTDRWWKRPICAFILAVCISAENWCAAAGTEYRLR
GPHHHGALLSTKGSIIVVICLTVGGFVFTVLSAVYSYWIQKDYANKAQKVALAAAVFDDRGRIMVSHEGLLPSEV
ITDTFIPTSNNDVFDTSNPVFHWMFWASRNWPRIAHVLPGMEAHVASLSSKTNRKLKLKLLGEDGEAVENYNMIL
CELYCLAASSLSLRMKEDIESTGMLWDEIFATGDVSGSFSRSSSSYSGGSELPMYRSSTSSIIKPETNEKHDDRG
NDGHGKGSLMFIVRHVSSRRDVERLEVAGFRFAEIHRVLGSIRTGMQIKTPDFAARLRIMSTFNEQDSDLRPGVH
VGLFALRARVDLGGFDVLVQRKAKNLLPTVHLQKESLRQWQKDIIERINGMTTPEIIENLNVDQFESARERHFAR
QLLEAITSLRSWTDQPIFDEARLNTSVVQVPCSSIDQSATCSVLTFQLMLPIHLTISFRNYEAIPLQFFKVRQFF
SQGFNGPGRTSTGVMAQNGLHFPNSSNSSLGGDSGPTTFMEFVKPGRPFRKNVPHRPSHHTLAQSFKRLSFGASG
RNARPGSAADDATGDTQPFAAAMAPPGQADLHHGHSILVSQEVVVNYQQSFDPEDDEMDITEKGTRETGSPSEQS
RQYRPGLSPPPEAESYSVTATGTDISRTKDEASFVDELLQSCMEQYKPMKKQ*
Coding >Ophcf2|06425
ATGCAGCTCCAGATGGCGTCTCCGCAGGAACTGTTCCTTCAGTATGAGGGCAAGCTCGTGCCTCACGACTACGAG
GCTGGTCTTGTTGTCGTCAGCGTCATCATTTGCTTCGTTGGCACCAGCTCTGCTCTTGAGCTCATCCGCCGGCAG
ACGTCCAACAAGGGACTCCACAACCTTCTTTTGCTTGCTGGCGCTGCCATTTGCATGGGCGGAATTGCCATGTGG
TCGATGCACTACATTGGCAACAGATCCGTTCGCTTCCTCGACGGACAGCGAGAGTTTCAGTTTGTCTACAAGACG
GGCCTCGCTGTTGTCGCACTCCTAATCCCCATCATCGTCTTGTTCGTGGCCTTCATCATCATCACCCGTCACGGA
AGAGTCTGCTGGGTGCGCATCACCCTCGCAGGTTTCATCTCCGGAGCGACGCTTGTGGGAATGCATTACCTCGTC
GACGCGTCCATAGACAATTACAAGCCCGTCTACCACGTTGGCAACATCGTCGGCGCCGCCTTGATAGGAGTCTTT
ACGAACATCGGCGCACTAGCCTTTCTCTTCGTCTTTGAGTCTGCTTGGACTGATAGGTGGTGGAAGAGGCCCATT
TGCGCCTTCATCCTGGCCGTTTGCATCTCGGCTGAGAACTGGTGCGCCGCCGCTGGAACAGAGTACAGACTGCGC
GGCCCTCACCACCATGGGGCGCTGCTATCGACCAAAGGCTCCATCATCGTCGTCATCTGCTTGACGGTTGGCGGC
TTCGTCTTCACCGTCCTGAGCGCCGTCTACTCGTACTGGATCCAGAAGGATTACGCCAACAAGGCGCAAAAGGTG
GCCCTGGCAGCAGCGGTCTTTGACGACCGCGGGAGAATCATGGTTAGCCACGAAGGTCTTCTTCCCAGCGAAGTC
ATCACCGACACCTTTATCCCGACTTCAAACAACGACGTCTTCGACACTTCTAACCCCGTCTTCCACTGGATGTTC
TGGGCGTCCCGCAACTGGCCCAGAATCGCACACGTCCTGCCAGGCATGGAAGCTCACGTGGCCAGCCTGTCGAGC
AAGACGAATCGCAAGCTGAAACTCAAGCTGCTAGGCGAAGATGGAGAGGCCGTCGAGAACTATAACATGATTCTC
TGCGAGCTGTACTGCCTCGCCGCCTCGTCGCTCTCGTTGCGGATGAAGGAAGACATTGAGTCGACGGGCATGCTC
TGGGACGAGATCTTTGCTACGGGTGATGTCTCGGGCTCTTTCAGCCGGTCTTCATCTTCATACAGCGGCGGCAGC
GAGCTGCCCATGTATCGCTCCTCGACAAGCTCCATCATCAAGCCGGAGACGAATGAGAAGCACGACGACCGGGGC
AATGACGGACACGGAAAGGGATCTCTCATGTTCATCGTCCGGCACGTCAGCAGCCGACGAGACGTGGAGAGGCTC
GAGGTAGCTGGCTTTCGCTTCGCCGAGATCCATCGTGTCCTCGGATCGATCCGGACGGGGATGCAGATCAAGACG
CCCGATTTCGCGGCTCGACTGCGCATCATGTCTACTTTCAACGAGCAGGATAGCGATCTCCGGCCTGGAGTTCAC
GTGGGACTCTTCGCTCTCCGTGCCAGAGTCGACCTTGGCGGCTTCGACGTGCTGGTTCAGCGCAAGGCCAAGAAT
CTGCTTCCGACGGTGCACCTTCAGAAGGAGTCGTTGAGACAGTGGCAGAAGGATATCATCGAGCGCATCAATGGA
ATGACGACGCCTGAAATCATCGAGAACCTCAACGTCGACCAATTCGAATCCGCACGGGAACGTCATTTCGCTCGC
CAGCTGCTCGAGGCCATCACCTCGCTACGATCGTGGACAGACCAGCCCATCTTCGACGAAGCCAGGCTCAACACT
AGCGTTGTCCAGGTTCCCTGCTCGTCCATCGACCAGTCTGCCACTTGCTCGGTCCTGACATTCCAGCTGATGCTC
CCGATCCACCTGACCATCTCGTTCCGGAACTACGAGGCCATCCCGCTGCAGTTCTTCAAGGTCCGTCAGTTCTTT
AGCCAGGGCTTCAATGGCCCTGGACGTACGTCTACCGGCGTTATGGCGCAAAACGGCCTGCACTTCCCCAACAGC
AGCAACTCGTCTCTTGGTGGGGATTCGGGCCCGACTACCTTTATGGAGTTTGTGAAGCCAGGCCGTCCGTTTAGG
AAGAACGTTCCGCACCGACCGTCGCACCATACCTTGGCCCAGAGCTTCAAGAGGCTGTCCTTTGGGGCTAGTGGC
CGCAACGCGAGGCCTGGTTCGGCGGCAGACGACGCTACCGGGGACACGCAACCCTTTGCGGCCGCTATGGCGCCT
CCGGGGCAGGCAGATCTGCATCATGGCCACAGCATCCTCGTCTCACAGGAGGTTGTGGTGAATTATCAACAGTCG
TTTGATCCCGAGGACGACGAGATGGACATTACGGAAAAGGGCACTCGGGAGACGGGCAGTCCGTCAGAACAATCC
CGTCAGTATCGGCCGGGCCTGTCACCGCCCCCTGAGGCCGAGTCGTACAGCGTCACGGCGACGGGGACGGATATC
AGCCGGACCAAGGACGAGGCCAGCTTCGTCGACGAGTTGCTGCAGAGCTGCATGGAACAGTACAAGCCCATGAAG
AAGCAATGA
Transcript >Ophcf2|06425
ATGCAGCTCCAGATGGCGTCTCCGCAGGAACTGTTCCTTCAGTATGAGGGCAAGCTCGTGCCTCACGACTACGAG
GCTGGTCTTGTTGTCGTCAGCGTCATCATTTGCTTCGTTGGCACCAGCTCTGCTCTTGAGCTCATCCGCCGGCAG
ACGTCCAACAAGGGACTCCACAACCTTCTTTTGCTTGCTGGCGCTGCCATTTGCATGGGCGGAATTGCCATGTGG
TCGATGCACTACATTGGCAACAGATCCGTTCGCTTCCTCGACGGACAGCGAGAGTTTCAGTTTGTCTACAAGACG
GGCCTCGCTGTTGTCGCACTCCTAATCCCCATCATCGTCTTGTTCGTGGCCTTCATCATCATCACCCGTCACGGA
AGAGTCTGCTGGGTGCGCATCACCCTCGCAGGTTTCATCTCCGGAGCGACGCTTGTGGGAATGCATTACCTCGTC
GACGCGTCCATAGACAATTACAAGCCCGTCTACCACGTTGGCAACATCGTCGGCGCCGCCTTGATAGGAGTCTTT
ACGAACATCGGCGCACTAGCCTTTCTCTTCGTCTTTGAGTCTGCTTGGACTGATAGGTGGTGGAAGAGGCCCATT
TGCGCCTTCATCCTGGCCGTTTGCATCTCGGCTGAGAACTGGTGCGCCGCCGCTGGAACAGAGTACAGACTGCGC
GGCCCTCACCACCATGGGGCGCTGCTATCGACCAAAGGCTCCATCATCGTCGTCATCTGCTTGACGGTTGGCGGC
TTCGTCTTCACCGTCCTGAGCGCCGTCTACTCGTACTGGATCCAGAAGGATTACGCCAACAAGGCGCAAAAGGTG
GCCCTGGCAGCAGCGGTCTTTGACGACCGCGGGAGAATCATGGTTAGCCACGAAGGTCTTCTTCCCAGCGAAGTC
ATCACCGACACCTTTATCCCGACTTCAAACAACGACGTCTTCGACACTTCTAACCCCGTCTTCCACTGGATGTTC
TGGGCGTCCCGCAACTGGCCCAGAATCGCACACGTCCTGCCAGGCATGGAAGCTCACGTGGCCAGCCTGTCGAGC
AAGACGAATCGCAAGCTGAAACTCAAGCTGCTAGGCGAAGATGGAGAGGCCGTCGAGAACTATAACATGATTCTC
TGCGAGCTGTACTGCCTCGCCGCCTCGTCGCTCTCGTTGCGGATGAAGGAAGACATTGAGTCGACGGGCATGCTC
TGGGACGAGATCTTTGCTACGGGTGATGTCTCGGGCTCTTTCAGCCGGTCTTCATCTTCATACAGCGGCGGCAGC
GAGCTGCCCATGTATCGCTCCTCGACAAGCTCCATCATCAAGCCGGAGACGAATGAGAAGCACGACGACCGGGGC
AATGACGGACACGGAAAGGGATCTCTCATGTTCATCGTCCGGCACGTCAGCAGCCGACGAGACGTGGAGAGGCTC
GAGGTAGCTGGCTTTCGCTTCGCCGAGATCCATCGTGTCCTCGGATCGATCCGGACGGGGATGCAGATCAAGACG
CCCGATTTCGCGGCTCGACTGCGCATCATGTCTACTTTCAACGAGCAGGATAGCGATCTCCGGCCTGGAGTTCAC
GTGGGACTCTTCGCTCTCCGTGCCAGAGTCGACCTTGGCGGCTTCGACGTGCTGGTTCAGCGCAAGGCCAAGAAT
CTGCTTCCGACGGTGCACCTTCAGAAGGAGTCGTTGAGACAGTGGCAGAAGGATATCATCGAGCGCATCAATGGA
ATGACGACGCCTGAAATCATCGAGAACCTCAACGTCGACCAATTCGAATCCGCACGGGAACGTCATTTCGCTCGC
CAGCTGCTCGAGGCCATCACCTCGCTACGATCGTGGACAGACCAGCCCATCTTCGACGAAGCCAGGCTCAACACT
AGCGTTGTCCAGGTTCCCTGCTCGTCCATCGACCAGTCTGCCACTTGCTCGGTCCTGACATTCCAGCTGATGCTC
CCGATCCACCTGACCATCTCGTTCCGGAACTACGAGGCCATCCCGCTGCAGTTCTTCAAGGTCCGTCAGTTCTTT
AGCCAGGGCTTCAATGGCCCTGGACGTACGTCTACCGGCGTTATGGCGCAAAACGGCCTGCACTTCCCCAACAGC
AGCAACTCGTCTCTTGGTGGGGATTCGGGCCCGACTACCTTTATGGAGTTTGTGAAGCCAGGCCGTCCGTTTAGG
AAGAACGTTCCGCACCGACCGTCGCACCATACCTTGGCCCAGAGCTTCAAGAGGCTGTCCTTTGGGGCTAGTGGC
CGCAACGCGAGGCCTGGTTCGGCGGCAGACGACGCTACCGGGGACACGCAACCCTTTGCGGCCGCTATGGCGCCT
CCGGGGCAGGCAGATCTGCATCATGGCCACAGCATCCTCGTCTCACAGGAGGTTGTGGTGAATTATCAACAGTCG
TTTGATCCCGAGGACGACGAGATGGACATTACGGAAAAGGGCACTCGGGAGACGGGCAGTCCGTCAGAACAATCC
CGTCAGTATCGGCCGGGCCTGTCACCGCCCCCTGAGGCCGAGTCGTACAGCGTCACGGCGACGGGGACGGATATC
AGCCGGACCAAGGACGAGGCCAGCTTCGTCGACGAGTTGCTGCAGAGCTGCATGGAACAGTACAAGCCCATGAAG
AAGCAATGA
Gene >Ophcf2|06425
ATGCAGCTCCAGATGGCGTCTCCGCAGGAACTGTTCCTTCAGTATGAGGGCAAGCTCGTGCCTCACGACTACGAG
GCTGGTCTTGTTGTCGTCAGCGTCATCATTTGCTTCGTTGGCACCAGCTCTGCTCTTGAGCTCATCCGCCGGCAG
ACGTCCAACAAGGGACTCCACAACCTGTAAGATCCGGGATTTTTTGAGTCGTGTGAGACTTGACTGACGTGATGC
TCTCTCAGTCTTTTGCTTGCTGGCGCTGCCATTTGCATGGGCGGAATTGCCATGTGGTCGATGGTGGGTGATGAC
ATGCAGGTCTTCTCCTTTTCCACCATGGCTAACAGTTGTCCCAGCACTACATTGGCAACAGATCCGTTCGCTTCC
TCGACGGACAGCGAGAGTTTCAGTTTGTCTACAAGACGGGCCTCGCTGTTGTCGCACTCCTAATCCCCATCATCG
TCTTGTTCGTGGCCTTCATCATCATCACCCGTCACGGAAGAGTCTGCTGGGTGCGCATCACCCTCGCAGGTTTCA
TCTCCGGAGCGACGCTTGTGGGAATGCATTACCTCGTCGACGCGTCCATAGACAATTACAAGCCCGTCTACCACG
TTGGCAACATCGTCGGCGCCGCCTTGATAGGAGTCTTTACGAACATCGGCGCACTAGCCTTTCTCTTCGTCTTTG
AGTCTGCTTGGACTGATAGGTGGTGGAAGAGGCCCATTTGCGCCTTCATCCTGGCCGTTTGCATCTCGGCTGAGA
ACTGGTGCGCCGCCGCTGGAACAGAGTACAGACTGCGCGGCCCTCACCACCATGGGGCGCTGCTATCGACCAAAG
GCTCCATCATCGTCGTCATCTGCTTGGTAAGTCTGCGCTTAGATACCCTTACTATGATGGTGAAGAAGTCTAACA
GAGAGTAAAGACGGTTGGCGGCTTCGTCTTCACCGTCCTGAGCGCCGTCTACTCGTACTGGATCCAGAAGGATTA
CGCCAACAAGGCGCAAAAGGTGGCCCTGGCAGCAGCGGTCTTTGACGACCGCGGGAGAATCATGGTTAGCCACGA
AGGTCTTCTTCCCAGCGAAGTCATCACCGACACCTTTATCCCGACTGTGAGTGTTTCGCTATTCCTTCTGTGTGA
GTTGGGAGATGCAGAAGCTGACATGGCAAAAACAGTCAAACAACGACGTCTTCGACACTTCTAACCCCGTCTTCC
ACTGGATGTTCTGGGCGTCCCGCAACTGGCCCAGAATCGCACACGTCCTGCCAGGCATGGAAGCTCACGTGGCCA
GCCTGTCGAGCAAGACGAATCGCAAGCTGAAACTCAAGCTGCTAGGCGAAGATGGAGAGGCCGTCGAGAACTATA
ACATGATTCTCTGCGAGCTGTACTGCCTCGCCGCCTCGTCGCTCTCGTTGCGGATGAAGGAAGACATTGAGTCGA
CGGGCATGCTCTGGGACGAGATCTTTGCTACGGGTGATGTCTCGGGCTCTTTCAGCCGGTCTTCATCTTCATACA
GCGGCGGCAGCGAGCTGCCCATGTATCGCTCCTCGACAAGCTCCATCATCAAGCCGGAGACGAATGAGAAGCACG
ACGACCGGGGCAATGACGGACACGGAAAGGGATCTCTCATGTTCATCGTCCGGCACGTCAGCAGCCGACGAGACG
TGGAGAGGCTCGAGGTAGCTGGCTTTCGCTTCGCCGAGATCCATCGTGTCCTCGGATCGATCCGGACGGGGATGC
AGATCAAGACGCCCGATTTCGCGGCTCGACTGCGCATCATGTCTACTTTCAACGAGCAGGATAGCGATCTCCGGC
CTGGAGTTCACGTGGGACTCTTCGCTCTCCGTGCCAGAGTCGACCTTGGCGGCTTCGACGTGCTGGTTCAGCGCA
AGGCCAAGAATCTGCTTCCGACGGTGCACCTTCAGAAGGAGTCGTTGAGACAGTGGCAGAAGGATATCATCGAGC
GCATCAATGGAATGACGACGCCTGAAATCATCGAGAACCTCAACGTCGACCAATTCGAATCCGCACGGGAACGTC
ATTTCGCTCGCCAGCTGCTCGAGGCCATCACCTCGCTACGATCGTGGACAGACCAGCCCATCTTCGACGAAGCCA
GGCTCAACACTAGCGTTGTCCAGGTTCCCTGCTCGTCCATCGACCAGTCTGCCACTTGCTCGGTCCTGACATTCC
AGCTGATGCTCCCGATCCACCTGACCATCTCGTTCCGGAACTACGAGGCCATCCCGCTGCAGTTCTTCAAGGTCC
GTCAGTTCTTTAGCCAGGGCTTCAATGGCCCTGGACGTACGTCTACCGGCGTTATGGCGCAAAACGGCCTGCACT
TCCCCAACAGCAGCAACTCGTCTCTTGGTGGGGATTCGGGCCCGACTACCTTTATGGAGTTTGTGAAGCCAGGCC
GTCCGTTTAGGAAGAACGTTCCGCACCGACCGTCGCACCATACCTTGGCCCAGAGCTTCAAGAGGCTGTCCTTTG
GGGCTAGTGGCCGCAACGCGAGGCCTGGTTCGGCGGCAGACGACGCTACCGGGGACACGCAACCCTTTGCGGCCG
CTATGGCGCCTCCGGGGCAGGCAGATCTGCATCATGGCCACAGCATCCTCGTCTCACAGGAGGTTGTGGTGAATT
ATCAACAGGTCCGTTGTTTCCACGCTGTGTTCTTTCTCTGGTTCTGATACAGATGCTAACATTCCTCTTCACAGT
CGTTTGATCCCGAGGACGACGAGATGGACATTACGGAAAAGGGCACTCGGGAGACGGGCAGTCCGTCAGAACAAT
CCCGTCAGTATCGGCCGGGCCTGTCACCGCCCCCTGAGGCCGAGTCGTACAGCGTCACGGCGACGGGGACGGATA
TCAGCCGGACCAAGGACGAGGCCAGCTTCGTCGACGAGTTGCTGCAGAGCTGCATGGAACAGTACAAGCCCATGA
AGAAGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail