Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06414
Gene name
Locationscaffold_07:2302117..2302960
Strand-
Gene length (bp)843
Transcript length (bp)843
Coding sequence length (bp)843
Protein length (aa) 281

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13964 Kelch_6 Kelch motif 9.3E-07 202 246
PF01344 Kelch_1 Kelch motif 1.1E-04 142 191
PF13415 Kelch_3 Galactose oxidase, central domain 5.8E-05 204 252
PF13854 Kelch_5 Kelch motif 3.6E-05 139 178
PF13418 Kelch_4 Galactose oxidase, central domain 2.6E-04 142 192
PF13418 Kelch_4 Galactose oxidase, central domain 1.8E-05 193 242

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular Signal peptide 0.7512 0.2146 0.816 0.2442 0.0923 0.0201 0.2157 0.346 0.1435 0.0696

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6769
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06414 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3494
Ophiocordyceps subramaniannii Hirsu2|8276

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06414
MAVLGGLTNVTTAMVQFYDMPSNTWSSGPDIPMPLNHLNAAVVNGNIYLLGGLAVLPNGTWSAIPYSWVYKPAEG
YWKPISPMPEGTARGSAVTVPYGNTIFLAGGETINVPGAYQDSTDIVSSYDTIRDEWRVLPARLPEPRQHATGAI
VDDVMYLIGGRTGGRRSVKDNVYALNLKRPDGQWESRANMPTPRGGIMGGVVGKSIYVFGGEGNPVPGTDGVFDD
TTVFDTVTGNWSVLEPMQKPRHGSQAVSVNDCIYIPGGSVVEGGPTVEYSDKFCP*
Coding >Ophcf2|06414
ATGGCTGTTCTCGGAGGTCTCACCAACGTCACGACAGCCATGGTACAGTTCTACGACATGCCCAGCAACACCTGG
TCGTCCGGTCCGGATATCCCCATGCCGCTAAACCACCTCAACGCGGCCGTCGTCAACGGCAACATCTACCTGCTG
GGCGGACTGGCCGTACTGCCCAACGGAACCTGGAGCGCTATTCCCTATAGCTGGGTATATAAGCCAGCCGAGGGA
TACTGGAAGCCCATCTCTCCCATGCCAGAGGGCACAGCACGCGGCTCGGCAGTCACGGTTCCATACGGAAACACC
ATCTTCCTAGCCGGCGGAGAGACCATCAACGTACCAGGCGCGTATCAAGACTCGACCGACATTGTCTCTTCTTAC
GACACGATCCGCGACGAGTGGCGCGTCCTGCCAGCACGTCTACCAGAGCCCAGACAGCACGCAACGGGAGCCATC
GTCGACGACGTCATGTACCTCATTGGCGGTCGCACCGGCGGACGAAGATCTGTAAAGGACAACGTGTACGCTCTC
AATCTGAAGCGTCCAGACGGACAGTGGGAGAGCCGGGCCAATATGCCGACTCCGCGCGGCGGCATCATGGGCGGC
GTCGTCGGCAAGTCCATCTACGTCTTTGGAGGAGAGGGAAATCCGGTGCCGGGGACGGACGGCGTCTTTGACGAT
ACTACTGTCTTCGACACGGTTACCGGCAATTGGTCCGTCTTGGAGCCTATGCAGAAGCCGCGCCACGGGTCTCAA
GCGGTCTCTGTTAATGATTGTATCTATATTCCCGGCGGGAGTGTTGTGGAGGGCGGTCCTACGGTGGAGTATTCT
GACAAGTTCTGCCCTTGA
Transcript >Ophcf2|06414
ATGGCTGTTCTCGGAGGTCTCACCAACGTCACGACAGCCATGGTACAGTTCTACGACATGCCCAGCAACACCTGG
TCGTCCGGTCCGGATATCCCCATGCCGCTAAACCACCTCAACGCGGCCGTCGTCAACGGCAACATCTACCTGCTG
GGCGGACTGGCCGTACTGCCCAACGGAACCTGGAGCGCTATTCCCTATAGCTGGGTATATAAGCCAGCCGAGGGA
TACTGGAAGCCCATCTCTCCCATGCCAGAGGGCACAGCACGCGGCTCGGCAGTCACGGTTCCATACGGAAACACC
ATCTTCCTAGCCGGCGGAGAGACCATCAACGTACCAGGCGCGTATCAAGACTCGACCGACATTGTCTCTTCTTAC
GACACGATCCGCGACGAGTGGCGCGTCCTGCCAGCACGTCTACCAGAGCCCAGACAGCACGCAACGGGAGCCATC
GTCGACGACGTCATGTACCTCATTGGCGGTCGCACCGGCGGACGAAGATCTGTAAAGGACAACGTGTACGCTCTC
AATCTGAAGCGTCCAGACGGACAGTGGGAGAGCCGGGCCAATATGCCGACTCCGCGCGGCGGCATCATGGGCGGC
GTCGTCGGCAAGTCCATCTACGTCTTTGGAGGAGAGGGAAATCCGGTGCCGGGGACGGACGGCGTCTTTGACGAT
ACTACTGTCTTCGACACGGTTACCGGCAATTGGTCCGTCTTGGAGCCTATGCAGAAGCCGCGCCACGGGTCTCAA
GCGGTCTCTGTTAATGATTGTATCTATATTCCCGGCGGGAGTGTTGTGGAGGGCGGTCCTACGGTGGAGTATTCT
GACAAGTTCTGCCCTTGA
Gene >Ophcf2|06414
ATGGCTGTTCTCGGAGGTCTCACCAACGTCACGACAGCCATGGTACAGTTCTACGACATGCCCAGCAACACCTGG
TCGTCCGGTCCGGATATCCCCATGCCGCTAAACCACCTCAACGCGGCCGTCGTCAACGGCAACATCTACCTGCTG
GGCGGACTGGCCGTACTGCCCAACGGAACCTGGAGCGCTATTCCCTATAGCTGGGTATATAAGCCAGCCGAGGGA
TACTGGAAGCCCATCTCTCCCATGCCAGAGGGCACAGCACGCGGCTCGGCAGTCACGGTTCCATACGGAAACACC
ATCTTCCTAGCCGGCGGAGAGACCATCAACGTACCAGGCGCGTATCAAGACTCGACCGACATTGTCTCTTCTTAC
GACACGATCCGCGACGAGTGGCGCGTCCTGCCAGCACGTCTACCAGAGCCCAGACAGCACGCAACGGGAGCCATC
GTCGACGACGTCATGTACCTCATTGGCGGTCGCACCGGCGGACGAAGATCTGTAAAGGACAACGTGTACGCTCTC
AATCTGAAGCGTCCAGACGGACAGTGGGAGAGCCGGGCCAATATGCCGACTCCGCGCGGCGGCATCATGGGCGGC
GTCGTCGGCAAGTCCATCTACGTCTTTGGAGGAGAGGGAAATCCGGTGCCGGGGACGGACGGCGTCTTTGACGAT
ACTACTGTCTTCGACACGGTTACCGGCAATTGGTCCGTCTTGGAGCCTATGCAGAAGCCGCGCCACGGGTCTCAA
GCGGTCTCTGTTAATGATTGTATCTATATTCCCGGCGGGAGTGTTGTGGAGGGCGGTCCTACGGTGGAGTATTCT
GACAAGTTCTGCCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail