Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06413
Gene name
Locationscaffold_07:2299256..2300669
Strand-
Gene length (bp)1413
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11309 DUF3112 Protein of unknown function (DUF3112) 6.3E-06 279 343

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 91 109 18
2 122 144 22
3 157 179 22
4 200 222 22
5 237 259 22
6 280 302 22
7 317 336 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.01 0.0 0.12
Alive In ants, during behavior modification 0.44 0.0 1.01
Dead In ants, recently dead 0.08 0.0 0.24

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 1.0 no
Alive Dead 1.0 no
Dead Fungus 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06413
MEAPMDAVTAPPGDAPPAPMEAPPDLPAMDMPPDPAAMMMPGAPPGAPPPGAPPGFPPGALPGAPPGLPPGPKDI
INGPFFGLVPTPVEDGLPALVFLLIFAAGYFLHARQLSRNRKRRHKFLLTVPFIAFCQTRIFTCLFRFIWAFLKA
PFPRGVVFMTLFFDNAGLPFVYGVNIVLAHRIVRVIQPAIGWHPVFNITVPVLLVTIPIILIASVIGLLVLFFAD
QNKINQEFIFDMLEAFAVWKVLLAIMPIIWIFVACALPGPPPRNFGTGNLRFKTSLVVFSSVTLAIGQAVRLAAT
ANPLLAFTGSAVFGKPMFYLIGFLLETFTVFSYVIFRFDNLFYVPDGARGPRDYERGMESAGWTTSRIKSAMAEL
GFKHEFLRPPEYSDRAPIYALIYPSSEEGLEPSSSTAPASAGGRKPPPQYIERSVERQTRNQSAFSWDSTADAKT
FI*
Coding >Ophcf2|06413
ATGGAGGCTCCTATGGATGCAGTGACAGCGCCTCCTGGAGACGCGCCTCCCGCTCCCATGGAGGCGCCGCCCGAT
CTACCCGCCATGGACATGCCACCGGATCCGGCCGCTATGATGATGCCGGGGGCTCCTCCCGGCGCTCCTCCCCCG
GGTGCTCCTCCCGGGTTTCCTCCCGGCGCTCTGCCCGGCGCCCCTCCCGGTCTCCCTCCAGGTCCCAAGGACATC
ATCAACGGGCCCTTCTTCGGCCTCGTTCCCACCCCCGTCGAGGACGGACTGCCGGCCCTCGTCTTCCTCCTCATC
TTCGCTGCGGGCTACTTCTTACACGCACGTCAGTTGAGCCGGAACAGAAAGCGGCGTCACAAGTTCCTCTTAACT
GTACCCTTCATCGCCTTTTGCCAGACGCGCATCTTCACTTGTCTCTTTCGCTTTATCTGGGCCTTTCTCAAGGCT
CCTTTCCCCCGAGGCGTCGTTTTCATGACACTCTTCTTCGACAACGCTGGCCTCCCTTTTGTTTACGGCGTCAAC
ATCGTCCTGGCGCATCGCATAGTCCGCGTCATTCAGCCTGCCATCGGCTGGCATCCCGTTTTCAACATCACCGTC
CCAGTCTTGCTCGTCACCATCCCAATCATTCTCATTGCTTCCGTCATTGGACTGCTTGTCCTCTTCTTCGCCGAT
CAAAACAAAATCAACCAAGAGTTTATCTTCGATATGCTCGAGGCCTTCGCAGTATGGAAGGTTTTGCTCGCCATC
ATGCCTATCATATGGATCTTCGTCGCCTGCGCATTGCCAGGACCGCCCCCGAGGAACTTTGGAACCGGAAATCTC
CGCTTCAAAACGTCGTTGGTCGTCTTCAGCTCCGTCACCCTGGCCATCGGACAGGCCGTGAGGCTCGCTGCGACG
GCTAACCCCCTGTTGGCCTTTACCGGATCCGCTGTTTTCGGAAAGCCCATGTTCTACCTAATAGGCTTCTTGCTC
GAAACCTTTACCGTCTTCTCATACGTAATCTTTCGGTTCGACAACCTTTTCTACGTCCCTGATGGCGCCCGAGGC
CCTCGCGACTACGAAAGGGGAATGGAATCTGCCGGCTGGACGACTTCTCGGATCAAGTCTGCCATGGCTGAGCTG
GGTTTCAAGCATGAGTTCTTGCGACCGCCCGAGTATTCGGATCGGGCGCCCATATACGCTCTTATATACCCATCT
TCTGAGGAGGGCTTGGAGCCTTCAAGTTCGACTGCACCAGCGTCTGCGGGAGGTCGTAAGCCGCCACCGCAATAC
ATAGAAAGAAGCGTGGAGCGGCAGACGAGAAACCAATCGGCCTTCAGCTGGGACTCGACGGCCGACGCAAAGACC
TTTATATAA
Transcript >Ophcf2|06413
ATGGAGGCTCCTATGGATGCAGTGACAGCGCCTCCTGGAGACGCGCCTCCCGCTCCCATGGAGGCGCCGCCCGAT
CTACCCGCCATGGACATGCCACCGGATCCGGCCGCTATGATGATGCCGGGGGCTCCTCCCGGCGCTCCTCCCCCG
GGTGCTCCTCCCGGGTTTCCTCCCGGCGCTCTGCCCGGCGCCCCTCCCGGTCTCCCTCCAGGTCCCAAGGACATC
ATCAACGGGCCCTTCTTCGGCCTCGTTCCCACCCCCGTCGAGGACGGACTGCCGGCCCTCGTCTTCCTCCTCATC
TTCGCTGCGGGCTACTTCTTACACGCACGTCAGTTGAGCCGGAACAGAAAGCGGCGTCACAAGTTCCTCTTAACT
GTACCCTTCATCGCCTTTTGCCAGACGCGCATCTTCACTTGTCTCTTTCGCTTTATCTGGGCCTTTCTCAAGGCT
CCTTTCCCCCGAGGCGTCGTTTTCATGACACTCTTCTTCGACAACGCTGGCCTCCCTTTTGTTTACGGCGTCAAC
ATCGTCCTGGCGCATCGCATAGTCCGCGTCATTCAGCCTGCCATCGGCTGGCATCCCGTTTTCAACATCACCGTC
CCAGTCTTGCTCGTCACCATCCCAATCATTCTCATTGCTTCCGTCATTGGACTGCTTGTCCTCTTCTTCGCCGAT
CAAAACAAAATCAACCAAGAGTTTATCTTCGATATGCTCGAGGCCTTCGCAGTATGGAAGGTTTTGCTCGCCATC
ATGCCTATCATATGGATCTTCGTCGCCTGCGCATTGCCAGGACCGCCCCCGAGGAACTTTGGAACCGGAAATCTC
CGCTTCAAAACGTCGTTGGTCGTCTTCAGCTCCGTCACCCTGGCCATCGGACAGGCCGTGAGGCTCGCTGCGACG
GCTAACCCCCTGTTGGCCTTTACCGGATCCGCTGTTTTCGGAAAGCCCATGTTCTACCTAATAGGCTTCTTGCTC
GAAACCTTTACCGTCTTCTCATACGTAATCTTTCGGTTCGACAACCTTTTCTACGTCCCTGATGGCGCCCGAGGC
CCTCGCGACTACGAAAGGGGAATGGAATCTGCCGGCTGGACGACTTCTCGGATCAAGTCTGCCATGGCTGAGCTG
GGTTTCAAGCATGAGTTCTTGCGACCGCCCGAGTATTCGGATCGGGCGCCCATATACGCTCTTATATACCCATCT
TCTGAGGAGGGCTTGGAGCCTTCAAGTTCGACTGCACCAGCGTCTGCGGGAGGTCGTAAGCCGCCACCGCAATAC
ATAGAAAGAAGCGTGGAGCGGCAGACGAGAAACCAATCGGCCTTCAGCTGGGACTCGACGGCCGACGCAAAGACC
TTTATATAA
Gene >Ophcf2|06413
ATGGAGGCTCCTATGGATGCAGTGACAGCGCCTCCTGGAGACGCGCCTCCCGCTCCCATGGAGGCGCCGCCCGAT
CTACCCGCCATGGACATGCCACCGGATCCGGCCGCTATGATGATGCCGGGGGCTCCTCCCGGCGCTCCTCCCCCG
GGTGCTCCTCCCGGGTTTCCTCCCGGCGCTCTGCCCGGCGCCCCTCCCGGTCTCCCTCCAGGTCCCAAGGACATC
ATCAACGGGCCCTTCTTCGGCCTCGTTCCCACCCCCGTCGAGGACGGACTGCCGGCCCTCGTCTTCCTCCTCATC
TTCGCTGCGGGCTACTTCTTACACGCACGTCAGTTGAGCCGGAACAGAAAGCGGCGTCACAAGTTCCTCTTAACT
GTACCCTTCATCGCCTTTTGCCAGACGCGCATCTTCACTTGTCTCTTTCGCTTTATCTGGGCCTTTCTCAAGGCT
CCTTTCCCCCGAGGCGTCGTTTTCATGACACTCTTCTTCGACAACGCTGGGTTCGTATTTGCTACTTCTCTCTCA
TCACTTCTCAGCTCACAATACATCTTCAGCCTCCCTTTTGTTTACGGCGTCAACATCGTCCTGGCGCATCGCATA
GTCCGCGTCATTCAGCCTGCCATCGGCTGGCATCCCGTTTTCAACATCACCGTCCCAGTCTTGCTCGTCACCATC
CCAATCATTCTCATTGCTTCCGTCATTGGACTGCTTGTCCTCTTCTTCGCCGATCAAAACAAAATCAACCAAGAG
TTTATCTTCGATATGCTCGAGGCCTTCGCAGTATGGAAGGTTTTGCTCGCCATCATGCCTATCATATGGATCTTC
GTCGCCTGCGCATTGCCAGGACCGCCCCCGAGGAACTTTGGAACCGGAAATCTCCGCTTCAAAACGTCGTTGGTC
GTCTTCAGCTCCGTCACCCTGGCCATCGGACAGGCCGTGAGGCTCGCTGCGACGGCTAACCCCCTGTTGGCCTTT
ACCGGATCCGCTGTTTTCGGAAAGCCCATGTTCTACCTAATAGGCTTCTTGCTCGAAACCTTTACCGTCTTCTCA
TACGTAATCTTTCGGTTCGACAACCTTTTCTACGTCCCTGATGGCGCCCGAGGCCCTCGCGACTACGAAAGGGGA
ATGGAATCTGCCGGCTGGACGACTTCTCGGATCAAGTCTGCCATGGCTGAGCTGGGTTTCAAGCATGAGTTCTTG
CGACCGCCCGAGTATTCGGATCGGGCGCCCATATACGCTCTTATATACCCATCTTCTGAGGAGGGCTTGGAGCCT
TCAAGTTCGACTGCACCAGCGTCTGCGGGAGGTCGTAAGCCGCCACCGCAATACATAGAAAGAAGCGTGGAGCGG
CAGACGAGAAACCAATCGGCCTTCAGCTGGGACTCGACGGCCGACGCAAAGACCTTTATATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail