Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06413
Gene name
Locationscaffold_07:2299256..2300669
Strand-
Gene length (bp)1413
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11309 DUF3112 Protein of unknown function (DUF3112) 6.3E-06 279 343

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 91 109 18
2 122 144 22
3 157 179 22
4 200 222 22
5 237 259 22
6 280 302 22
7 317 336 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06413
MEAPMDAVTAPPGDAPPAPMEAPPDLPAMDMPPDPAAMMMPGAPPGAPPPGAPPGFPPGALPGAPPGLPPGPKDI
INGPFFGLVPTPVEDGLPALVFLLIFAAGYFLHARQLSRNRKRRHKFLLTVPFIAFCQTRIFTCLFRFIWAFLKA
PFPRGVVFMTLFFDNAGLPFVYGVNIVLAHRIVRVIQPAIGWHPVFNITVPVLLVTIPIILIASVIGLLVLFFAD
QNKINQEFIFDMLEAFAVWKVLLAIMPIIWIFVACALPGPPPRNFGTGNLRFKTSLVVFSSVTLAIGQAVRLAAT
ANPLLAFTGSAVFGKPMFYLIGFLLETFTVFSYVIFRFDNLFYVPDGARGPRDYERGMESAGWTTSRIKSAMAEL
GFKHEFLRPPEYSDRAPIYALIYPSSEEGLEPSSSTAPASAGGRKPPPQYIERSVERQTRNQSAFSWDSTADAKT
FI*
Coding >Ophcf2|06413
ATGGAGGCTCCTATGGATGCAGTGACAGCGCCTCCTGGAGACGCGCCTCCCGCTCCCATGGAGGCGCCGCCCGAT
CTACCCGCCATGGACATGCCACCGGATCCGGCCGCTATGATGATGCCGGGGGCTCCTCCCGGCGCTCCTCCCCCG
GGTGCTCCTCCCGGGTTTCCTCCCGGCGCTCTGCCCGGCGCCCCTCCCGGTCTCCCTCCAGGTCCCAAGGACATC
ATCAACGGGCCCTTCTTCGGCCTCGTTCCCACCCCCGTCGAGGACGGACTGCCGGCCCTCGTCTTCCTCCTCATC
TTCGCTGCGGGCTACTTCTTACACGCACGTCAGTTGAGCCGGAACAGAAAGCGGCGTCACAAGTTCCTCTTAACT
GTACCCTTCATCGCCTTTTGCCAGACGCGCATCTTCACTTGTCTCTTTCGCTTTATCTGGGCCTTTCTCAAGGCT
CCTTTCCCCCGAGGCGTCGTTTTCATGACACTCTTCTTCGACAACGCTGGCCTCCCTTTTGTTTACGGCGTCAAC
ATCGTCCTGGCGCATCGCATAGTCCGCGTCATTCAGCCTGCCATCGGCTGGCATCCCGTTTTCAACATCACCGTC
CCAGTCTTGCTCGTCACCATCCCAATCATTCTCATTGCTTCCGTCATTGGACTGCTTGTCCTCTTCTTCGCCGAT
CAAAACAAAATCAACCAAGAGTTTATCTTCGATATGCTCGAGGCCTTCGCAGTATGGAAGGTTTTGCTCGCCATC
ATGCCTATCATATGGATCTTCGTCGCCTGCGCATTGCCAGGACCGCCCCCGAGGAACTTTGGAACCGGAAATCTC
CGCTTCAAAACGTCGTTGGTCGTCTTCAGCTCCGTCACCCTGGCCATCGGACAGGCCGTGAGGCTCGCTGCGACG
GCTAACCCCCTGTTGGCCTTTACCGGATCCGCTGTTTTCGGAAAGCCCATGTTCTACCTAATAGGCTTCTTGCTC
GAAACCTTTACCGTCTTCTCATACGTAATCTTTCGGTTCGACAACCTTTTCTACGTCCCTGATGGCGCCCGAGGC
CCTCGCGACTACGAAAGGGGAATGGAATCTGCCGGCTGGACGACTTCTCGGATCAAGTCTGCCATGGCTGAGCTG
GGTTTCAAGCATGAGTTCTTGCGACCGCCCGAGTATTCGGATCGGGCGCCCATATACGCTCTTATATACCCATCT
TCTGAGGAGGGCTTGGAGCCTTCAAGTTCGACTGCACCAGCGTCTGCGGGAGGTCGTAAGCCGCCACCGCAATAC
ATAGAAAGAAGCGTGGAGCGGCAGACGAGAAACCAATCGGCCTTCAGCTGGGACTCGACGGCCGACGCAAAGACC
TTTATATAA
Transcript >Ophcf2|06413
ATGGAGGCTCCTATGGATGCAGTGACAGCGCCTCCTGGAGACGCGCCTCCCGCTCCCATGGAGGCGCCGCCCGAT
CTACCCGCCATGGACATGCCACCGGATCCGGCCGCTATGATGATGCCGGGGGCTCCTCCCGGCGCTCCTCCCCCG
GGTGCTCCTCCCGGGTTTCCTCCCGGCGCTCTGCCCGGCGCCCCTCCCGGTCTCCCTCCAGGTCCCAAGGACATC
ATCAACGGGCCCTTCTTCGGCCTCGTTCCCACCCCCGTCGAGGACGGACTGCCGGCCCTCGTCTTCCTCCTCATC
TTCGCTGCGGGCTACTTCTTACACGCACGTCAGTTGAGCCGGAACAGAAAGCGGCGTCACAAGTTCCTCTTAACT
GTACCCTTCATCGCCTTTTGCCAGACGCGCATCTTCACTTGTCTCTTTCGCTTTATCTGGGCCTTTCTCAAGGCT
CCTTTCCCCCGAGGCGTCGTTTTCATGACACTCTTCTTCGACAACGCTGGCCTCCCTTTTGTTTACGGCGTCAAC
ATCGTCCTGGCGCATCGCATAGTCCGCGTCATTCAGCCTGCCATCGGCTGGCATCCCGTTTTCAACATCACCGTC
CCAGTCTTGCTCGTCACCATCCCAATCATTCTCATTGCTTCCGTCATTGGACTGCTTGTCCTCTTCTTCGCCGAT
CAAAACAAAATCAACCAAGAGTTTATCTTCGATATGCTCGAGGCCTTCGCAGTATGGAAGGTTTTGCTCGCCATC
ATGCCTATCATATGGATCTTCGTCGCCTGCGCATTGCCAGGACCGCCCCCGAGGAACTTTGGAACCGGAAATCTC
CGCTTCAAAACGTCGTTGGTCGTCTTCAGCTCCGTCACCCTGGCCATCGGACAGGCCGTGAGGCTCGCTGCGACG
GCTAACCCCCTGTTGGCCTTTACCGGATCCGCTGTTTTCGGAAAGCCCATGTTCTACCTAATAGGCTTCTTGCTC
GAAACCTTTACCGTCTTCTCATACGTAATCTTTCGGTTCGACAACCTTTTCTACGTCCCTGATGGCGCCCGAGGC
CCTCGCGACTACGAAAGGGGAATGGAATCTGCCGGCTGGACGACTTCTCGGATCAAGTCTGCCATGGCTGAGCTG
GGTTTCAAGCATGAGTTCTTGCGACCGCCCGAGTATTCGGATCGGGCGCCCATATACGCTCTTATATACCCATCT
TCTGAGGAGGGCTTGGAGCCTTCAAGTTCGACTGCACCAGCGTCTGCGGGAGGTCGTAAGCCGCCACCGCAATAC
ATAGAAAGAAGCGTGGAGCGGCAGACGAGAAACCAATCGGCCTTCAGCTGGGACTCGACGGCCGACGCAAAGACC
TTTATATAA
Gene >Ophcf2|06413
ATGGAGGCTCCTATGGATGCAGTGACAGCGCCTCCTGGAGACGCGCCTCCCGCTCCCATGGAGGCGCCGCCCGAT
CTACCCGCCATGGACATGCCACCGGATCCGGCCGCTATGATGATGCCGGGGGCTCCTCCCGGCGCTCCTCCCCCG
GGTGCTCCTCCCGGGTTTCCTCCCGGCGCTCTGCCCGGCGCCCCTCCCGGTCTCCCTCCAGGTCCCAAGGACATC
ATCAACGGGCCCTTCTTCGGCCTCGTTCCCACCCCCGTCGAGGACGGACTGCCGGCCCTCGTCTTCCTCCTCATC
TTCGCTGCGGGCTACTTCTTACACGCACGTCAGTTGAGCCGGAACAGAAAGCGGCGTCACAAGTTCCTCTTAACT
GTACCCTTCATCGCCTTTTGCCAGACGCGCATCTTCACTTGTCTCTTTCGCTTTATCTGGGCCTTTCTCAAGGCT
CCTTTCCCCCGAGGCGTCGTTTTCATGACACTCTTCTTCGACAACGCTGGGTTCGTATTTGCTACTTCTCTCTCA
TCACTTCTCAGCTCACAATACATCTTCAGCCTCCCTTTTGTTTACGGCGTCAACATCGTCCTGGCGCATCGCATA
GTCCGCGTCATTCAGCCTGCCATCGGCTGGCATCCCGTTTTCAACATCACCGTCCCAGTCTTGCTCGTCACCATC
CCAATCATTCTCATTGCTTCCGTCATTGGACTGCTTGTCCTCTTCTTCGCCGATCAAAACAAAATCAACCAAGAG
TTTATCTTCGATATGCTCGAGGCCTTCGCAGTATGGAAGGTTTTGCTCGCCATCATGCCTATCATATGGATCTTC
GTCGCCTGCGCATTGCCAGGACCGCCCCCGAGGAACTTTGGAACCGGAAATCTCCGCTTCAAAACGTCGTTGGTC
GTCTTCAGCTCCGTCACCCTGGCCATCGGACAGGCCGTGAGGCTCGCTGCGACGGCTAACCCCCTGTTGGCCTTT
ACCGGATCCGCTGTTTTCGGAAAGCCCATGTTCTACCTAATAGGCTTCTTGCTCGAAACCTTTACCGTCTTCTCA
TACGTAATCTTTCGGTTCGACAACCTTTTCTACGTCCCTGATGGCGCCCGAGGCCCTCGCGACTACGAAAGGGGA
ATGGAATCTGCCGGCTGGACGACTTCTCGGATCAAGTCTGCCATGGCTGAGCTGGGTTTCAAGCATGAGTTCTTG
CGACCGCCCGAGTATTCGGATCGGGCGCCCATATACGCTCTTATATACCCATCTTCTGAGGAGGGCTTGGAGCCT
TCAAGTTCGACTGCACCAGCGTCTGCGGGAGGTCGTAAGCCGCCACCGCAATACATAGAAAGAAGCGTGGAGCGG
CAGACGAGAAACCAATCGGCCTTCAGCTGGGACTCGACGGCCGACGCAAAGACCTTTATATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail