Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06412
Gene name
Locationscaffold_07:2297730..2298684
Strand-
Gene length (bp)954
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01956 EMC3_TMCO1 Integral membrane protein EMC3/TMCO1-like 4.7E-54 10 201

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain 0.2037 0.1863 0.0115 0.1399 0.1876 0.0033 0.8885 0.1195 0.273 0.0121

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 126 148 22
3 175 197 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4701
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1051
Ophiocordyceps australis map64 (Brazil) OphauB2|7180
Ophiocordyceps camponoti-floridani Ophcf2|06412 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3492
Ophiocordyceps kimflemingae Ophio5|6413
Ophiocordyceps subramaniannii Hirsu2|9899

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06412
MAQTPVQTLHRDPQLFYWILIPITVVMVLTGVLRHYASVLMSAAPKRVDARTMREQRALARGHALRSNFHVLSQR
AFESRRQFLVDGYEAGTFLKDPDRKGQPPANPLSDPSQMDGMMSMMKNNMAMIIPNTLIMSWINAFFSGYVIMKL
PFPITIKFKSMLQAGVQTKDMDPRWMSSISWYFLCIFGLQFVYVFLLGSDNAASQMAQQMAAQQMPMGPMGGPGQ
DPDKQFKMEAENLAVVEHYSILDGVEERLLQGIKS*
Coding >Ophcf2|06412
ATGGCCCAGACACCCGTGCAGACCCTTCACAGGGACCCTCAGCTATTCTACTGGATTCTCATCCCCATCACCGTC
GTCATGGTCCTCACGGGCGTGCTGCGCCACTATGCCTCGGTCCTCATGTCCGCGGCTCCCAAGCGAGTCGACGCT
AGGACCATGCGGGAGCAGCGCGCACTCGCCCGCGGTCACGCTCTGCGCTCCAATTTTCACGTTCTCTCCCAGCGC
GCGTTCGAGTCTCGACGCCAGTTTCTGGTCGATGGCTACGAGGCGGGGACTTTTCTCAAGGATCCGGATCGCAAG
GGACAGCCGCCTGCCAACCCGCTGAGCGATCCGAGTCAGATGGATGGCATGATGAGCATGATGAAGAACAACATG
GCCATGATCATTCCCAATACGCTCATTATGAGCTGGATCAATGCTTTTTTCAGCGGCTACGTCATCATGAAACTC
CCCTTCCCCATCACCATCAAGTTCAAGAGCATGCTGCAGGCCGGCGTGCAGACCAAGGACATGGATCCACGGTGG
ATGTCGAGCATCAGCTGGTACTTTCTGTGCATATTCGGCCTTCAGTTTGTCTACGTTTTTCTCCTCGGTAGCGAT
AACGCCGCCAGCCAGATGGCTCAGCAGATGGCCGCCCAGCAGATGCCCATGGGACCTATGGGCGGTCCCGGACAA
GATCCGGACAAACAGTTCAAGATGGAGGCGGAAAACCTTGCCGTGGTGGAGCACTACTCCATCCTAGACGGCGTC
GAAGAGCGGCTTCTCCAGGGTATCAAGTCGTAG
Transcript >Ophcf2|06412
ATGGCCCAGACACCCGTGCAGACCCTTCACAGGGACCCTCAGCTATTCTACTGGATTCTCATCCCCATCACCGTC
GTCATGGTCCTCACGGGCGTGCTGCGCCACTATGCCTCGGTCCTCATGTCCGCGGCTCCCAAGCGAGTCGACGCT
AGGACCATGCGGGAGCAGCGCGCACTCGCCCGCGGTCACGCTCTGCGCTCCAATTTTCACGTTCTCTCCCAGCGC
GCGTTCGAGTCTCGACGCCAGTTTCTGGTCGATGGCTACGAGGCGGGGACTTTTCTCAAGGATCCGGATCGCAAG
GGACAGCCGCCTGCCAACCCGCTGAGCGATCCGAGTCAGATGGATGGCATGATGAGCATGATGAAGAACAACATG
GCCATGATCATTCCCAATACGCTCATTATGAGCTGGATCAATGCTTTTTTCAGCGGCTACGTCATCATGAAACTC
CCCTTCCCCATCACCATCAAGTTCAAGAGCATGCTGCAGGCCGGCGTGCAGACCAAGGACATGGATCCACGGTGG
ATGTCGAGCATCAGCTGGTACTTTCTGTGCATATTCGGCCTTCAGTTTGTCTACGTTTTTCTCCTCGGTAGCGAT
AACGCCGCCAGCCAGATGGCTCAGCAGATGGCCGCCCAGCAGATGCCCATGGGACCTATGGGCGGTCCCGGACAA
GATCCGGACAAACAGTTCAAGATGGAGGCGGAAAACCTTGCCGTGGTGGAGCACTACTCCATCCTAGACGGCGTC
GAAGAGCGGCTTCTCCAGGGTATCAAGTCGTAG
Gene >Ophcf2|06412
ATGGCCCAGACACCCGTGCAGACCCTTCACAGGGACCCTCAGCTATTGTCAGTCTTGCCCCCAGCACGTGTTCAC
GCTTCCCCCCAAGCTGACAAGACGTTGCCTCGCAGCTACTGGATTCTCATCCCCATCACCGTCGTCATGGTCCTC
ACGGGCGTGCTGCGCCACTATGCCTCGGTCCTCATGTCCGCGGCTCCCAAGCGAGTCGACGCTAGGACCATGCGG
GAGCAGCGCGCACTCGCCCGCGGTCACGCTCTGCGCTCCAATTTTCACGTTCTCTCCCAGCGCGCGTTCGAGTCT
CGACGCCAGTTTCTGGTCGATGGCTACGAGGCGGGGACTTTTCTCAAGGATCCGGATCGCAAGGGACAGCCGCCT
GCCAACCCGCTGAGCGATCCGAGTCAGATGGATGGCATGATGAGCATGATGAAGAACAACATGGCCATGATCATT
CCCAATACGCTCATTATGAGCTGGATCAATGCTTTTTTCAGCGGCTACGTCATCAGTAGTTTTCCCAATCATCAA
CCCGCTCCACGATCACAACTGACATCCATCAGTGAAACTCCCCTTCCCCATCACCATCAAGTTCAAGAGCATGCT
GCAGGCCGGCGTGCAGACCAAGGACATGGATCCACGGTGGATGTCGAGCATCAGCTGGTACTTTCTGTGCATATT
CGGCCTTCAGTTTGTCTACGTTTTTCTCCTCGGTAGCGATAACGGTGAGCCGCTCTTCCTGTCAGGTGTTGGCCT
GTGTCCCGCGCTGATCCGACGACAGCCGCCAGCCAGATGGCTCAGCAGATGGCCGCCCAGCAGATGCCCATGGGA
CCTATGGGCGGTCCCGGACAAGATCCGGACAAACAGTTCAAGATGGAGGCGGAAAACCTTGCCGTGGTGGAGCAC
TACTCCATCCTAGACGGCGTCGAAGAGCGGCTTCTCCAGGGTATCAAGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail