Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06410
Gene name
Locationscaffold_07:2294545..2296383
Strand-
Gene length (bp)1838
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10453 NUFIP1 Nuclear fragile X mental retardation-interacting protein 1 (NUFIP1) 4.9E-08 292 323

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2819 0.8778 0.0426 0.0042 0.0528 0.0041 0.0538 0.0084 0.0173 0.007

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2783
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1053
Ophiocordyceps australis map64 (Brazil) OphauB2|7182
Ophiocordyceps camponoti-floridani Ophcf2|06410 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3490
Ophiocordyceps kimflemingae Ophio5|6411
Ophiocordyceps subramaniannii Hirsu2|4443

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06410
MAGYGYGPPPPPPLPSSYGQSTSSYGYHGHHRGGGVSGGRGRGGQYSRGRGDFHAAPAPPLHYEYGAQPYSYPVS
QPPTVTYPPHPQQWTPEHFSPQPPYGPPQQYGNPYHAPAAPQHWSALGSAQQGHYGRGARSGPKPPHKGYEHESP
APVGVGYVQPYSHDPRTPHYPPAHYAYPGPPPPPAHGHHEASHGQYHRRSRGGGYRDGARGRGGYHNNNGYSGGD
KARHQQRQATAPEVKVKTESPSLGKKKKRKTNTLGLTPGMDSESEDDEGEEKALLDLIGPETLQITDVAAFLAER
RKNYPTKERVEAKKAAELARREADKAALLEKQADRLRRQLRRVESSIKRKREQGDEGDEMRDSSEEPSDDEKPEV
MSSRLETAATPDASAKKADVSRHCKYYSTGGTCGKKGKCRFVHDPEVREAAIKEREANDGRMTIQQRLILNDKEQ
EDLTILQSIQYLREKGLMKPAPQAQTSSDKNKADKSRVLRAERPQKPVAAVSSLLPAAPASLPDPPIKREAGSGR
RNAPSSAASSGLEHYQGWLLQPYGSTDGKQAMTDDLP*
Coding >Ophcf2|06410
ATGGCCGGCTACGGTTACGGCCCACCGCCGCCACCGCCGCTGCCTTCTTCCTACGGTCAGTCGACCTCATCGTAC
GGCTATCATGGTCATCATCGTGGAGGGGGAGTCTCTGGCGGACGCGGTCGCGGCGGACAGTATTCCCGTGGTCGA
GGTGACTTCCACGCCGCTCCGGCTCCTCCCCTTCACTACGAATACGGAGCCCAGCCATACAGCTACCCCGTCTCG
CAACCTCCCACCGTCACATATCCGCCTCATCCGCAGCAGTGGACCCCCGAACACTTCTCTCCTCAACCGCCGTAC
GGCCCGCCCCAGCAGTATGGGAACCCATATCACGCCCCGGCCGCGCCCCAGCATTGGAGCGCTCTCGGTTCGGCG
CAGCAGGGACATTACGGCAGAGGAGCTCGGTCTGGTCCCAAGCCCCCTCATAAGGGTTACGAGCACGAGTCACCC
GCCCCAGTTGGCGTTGGCTACGTCCAGCCCTATTCCCACGACCCTCGCACACCCCATTACCCGCCTGCCCATTAC
GCTTATCCGGGACCTCCGCCGCCTCCGGCTCACGGCCACCACGAAGCCAGTCATGGTCAGTACCATCGTCGTAGC
CGCGGTGGTGGCTACAGAGACGGTGCACGCGGACGAGGAGGCTACCATAATAACAACGGCTATTCTGGTGGAGAC
AAGGCTCGCCATCAACAGCGGCAGGCCACCGCGCCCGAAGTAAAGGTCAAGACCGAATCGCCCTCGCTGGGAAAG
AAGAAGAAACGCAAGACAAATACTCTCGGCTTGACTCCCGGTATGGACTCTGAGTCGGAAGACGACGAGGGAGAA
GAGAAAGCTCTCCTCGATCTCATCGGACCCGAGACCCTGCAGATTACCGATGTCGCTGCATTTTTGGCCGAGCGG
CGGAAAAACTACCCAACAAAAGAGCGCGTCGAGGCCAAGAAGGCTGCCGAGTTGGCAAGGAGAGAAGCGGACAAG
GCCGCCTTGCTGGAGAAGCAGGCCGACAGACTCCGAAGGCAGCTTCGGAGAGTCGAGTCATCTATCAAGCGTAAG
CGAGAGCAAGGCGACGAGGGTGACGAGATGAGAGACTCGTCGGAAGAGCCTTCAGACGATGAGAAGCCCGAAGTC
ATGTCTTCTCGTCTTGAAACGGCCGCCACCCCTGACGCCTCGGCCAAGAAGGCCGATGTCTCGAGGCACTGCAAA
TACTATTCCACCGGTGGGACCTGCGGCAAGAAGGGCAAGTGCCGCTTCGTTCATGATCCTGAAGTTAGAGAAGCG
GCTATCAAGGAGCGAGAGGCCAACGACGGCCGCATGACGATCCAGCAGCGCCTCATCCTGAACGACAAGGAGCAG
GAGGACCTGACCATTCTCCAGTCGATTCAGTACTTGCGCGAAAAGGGGCTCATGAAGCCGGCGCCCCAGGCACAG
ACGAGCAGCGACAAGAACAAGGCCGACAAGAGCCGCGTCTTGAGAGCGGAGAGGCCGCAGAAGCCAGTGGCCGCC
GTGTCGAGCCTGCTGCCGGCCGCCCCGGCCTCACTTCCGGATCCGCCGATCAAGAGGGAGGCCGGCTCCGGCCGT
CGGAACGCGCCGTCATCCGCCGCGAGTTCGGGACTGGAACACTACCAGGGCTGGCTGTTGCAGCCGTACGGCAGC
ACCGACGGGAAGCAGGCCATGACCGATGACTTGCCATGA
Transcript >Ophcf2|06410
ATGGCCGGCTACGGTTACGGCCCACCGCCGCCACCGCCGCTGCCTTCTTCCTACGGTCAGTCGACCTCATCGTAC
GGCTATCATGGTCATCATCGTGGAGGGGGAGTCTCTGGCGGACGCGGTCGCGGCGGACAGTATTCCCGTGGTCGA
GGTGACTTCCACGCCGCTCCGGCTCCTCCCCTTCACTACGAATACGGAGCCCAGCCATACAGCTACCCCGTCTCG
CAACCTCCCACCGTCACATATCCGCCTCATCCGCAGCAGTGGACCCCCGAACACTTCTCTCCTCAACCGCCGTAC
GGCCCGCCCCAGCAGTATGGGAACCCATATCACGCCCCGGCCGCGCCCCAGCATTGGAGCGCTCTCGGTTCGGCG
CAGCAGGGACATTACGGCAGAGGAGCTCGGTCTGGTCCCAAGCCCCCTCATAAGGGTTACGAGCACGAGTCACCC
GCCCCAGTTGGCGTTGGCTACGTCCAGCCCTATTCCCACGACCCTCGCACACCCCATTACCCGCCTGCCCATTAC
GCTTATCCGGGACCTCCGCCGCCTCCGGCTCACGGCCACCACGAAGCCAGTCATGGTCAGTACCATCGTCGTAGC
CGCGGTGGTGGCTACAGAGACGGTGCACGCGGACGAGGAGGCTACCATAATAACAACGGCTATTCTGGTGGAGAC
AAGGCTCGCCATCAACAGCGGCAGGCCACCGCGCCCGAAGTAAAGGTCAAGACCGAATCGCCCTCGCTGGGAAAG
AAGAAGAAACGCAAGACAAATACTCTCGGCTTGACTCCCGGTATGGACTCTGAGTCGGAAGACGACGAGGGAGAA
GAGAAAGCTCTCCTCGATCTCATCGGACCCGAGACCCTGCAGATTACCGATGTCGCTGCATTTTTGGCCGAGCGG
CGGAAAAACTACCCAACAAAAGAGCGCGTCGAGGCCAAGAAGGCTGCCGAGTTGGCAAGGAGAGAAGCGGACAAG
GCCGCCTTGCTGGAGAAGCAGGCCGACAGACTCCGAAGGCAGCTTCGGAGAGTCGAGTCATCTATCAAGCGTAAG
CGAGAGCAAGGCGACGAGGGTGACGAGATGAGAGACTCGTCGGAAGAGCCTTCAGACGATGAGAAGCCCGAAGTC
ATGTCTTCTCGTCTTGAAACGGCCGCCACCCCTGACGCCTCGGCCAAGAAGGCCGATGTCTCGAGGCACTGCAAA
TACTATTCCACCGGTGGGACCTGCGGCAAGAAGGGCAAGTGCCGCTTCGTTCATGATCCTGAAGTTAGAGAAGCG
GCTATCAAGGAGCGAGAGGCCAACGACGGCCGCATGACGATCCAGCAGCGCCTCATCCTGAACGACAAGGAGCAG
GAGGACCTGACCATTCTCCAGTCGATTCAGTACTTGCGCGAAAAGGGGCTCATGAAGCCGGCGCCCCAGGCACAG
ACGAGCAGCGACAAGAACAAGGCCGACAAGAGCCGCGTCTTGAGAGCGGAGAGGCCGCAGAAGCCAGTGGCCGCC
GTGTCGAGCCTGCTGCCGGCCGCCCCGGCCTCACTTCCGGATCCGCCGATCAAGAGGGAGGCCGGCTCCGGCCGT
CGGAACGCGCCGTCATCCGCCGCGAGTTCGGGACTGGAACACTACCAGGGCTGGCTGTTGCAGCCGTACGGCAGC
ACCGACGGGAAGCAGGCCATGACCGATGACTTGCCATGA
Gene >Ophcf2|06410
ATGGCCGGCTACGGTTACGGCCCACCGCCGCCACCGCCGCTGCCTTCTTCCTACGGTCAGTCGACCTCATCGTAC
GGCTATCATGGTCATCATCGTGGAGGGGGAGTCTCTGGCGGACGCGGTCGCGGCGGACAGTATTCCCGTGGTCGA
GGTGACTTCCACGCCGCTCCGGCTCCTCCCCTTCACTACGAATACGGAGCCCAGCCATACAGCTACCCCGTCTCG
CAACCTCCCACCGTCACATATCCGCCTCATCCGCAGCAGTGGACCCCCGAACACGTTCCCCCCCCTCCAACACCC
ATCCCCATGCCCCAACACCCATCTCCCCTTCCAACTACCATCCCAACTACGCACCTCATTACCCGCCCTCTCAGT
TCTCTCCTCAACCGCCGTACGGCCCGCCCCAGCAGTATGGGAACCCATATCACGCCCCGGCCGCGCCCCAGCATT
GGAGCGCTCTCGGTTCGGCGCAGCAGGGACATTACGGCAGAGGAGCTCGGTCTGGTCCCAAGCCCCCTCATAAGG
GTTACGAGCACGAGTCACCCGCCCCAGTTGGCGTTGGCTACGTCCAGCCCTATTCCCACGACCCTCGCACACCCC
ATTACCCGCCTGCCCATTACGCTTATCCGGGACCTCCGCCGCCTCCGGCTCACGGCCACCACGAAGCCAGTCATG
GTCAGTACCATCGTCGTAGCCGCGGTGGTGGCTACAGAGACGGTGCACGCGGACGAGGAGGCTACCATAATAACA
ACGGCTATTCTGGTGGAGACAAGGCTCGCCATCAACAGCGGCAGGCCACCGCGCCCGAAGTAAAGGTCAAGACCG
AATCGCCCTCGCTGGGAAAGAAGAAGAAACGCAAGACAAATACTCTCGGCTTGACTCCCGGTATGGACTCTGAGT
CGGAAGACGACGAGGGAGAAGAGAAAGCTCTCCTCGATCTCATCGGACCCGAGACCCTGCAGTAAGTTCTAACCC
CTTGTCATATCTGTCACCCTTCTGTTAACTGGCAGTATAGGATTACCGATGTCGCTGCATTTTTGGCCGAGCGGC
GGAAAAACTACCCAACAAAAGAGCGCGTCGAGGCCAAGAAGGCTGCCGAGTTGGCAAGGAGAGAAGCGGACAAGG
CCGCCTTGCTGGAGAAGCAGGCCGACAGACTCCGAAGGCAGCTTCGGAGAGTCGAGTCATCTATCAAGCGTAAGC
GAGAGCAAGGCGACGAGGGTGACGAGATGAGAGACTCGTCGGAAGAGCCTTCAGACGATGAGAAGCCCGAAGTCA
TGTCTTCTCGTCTTGAAACGGCCGCCACCCCTGACGCCTCGGCCAAGAAGGCCGATGTCTCGAGGCACTGCAAAT
ACTATTCCACCGGTGGGACCTGCGGCAAGAAGGGCAAGTGCCGCTTCGTTCATGATCCTGAAGTTAGAGAAGCGG
CTATCAAGGAGCGAGAGGCCAACGACGGCCGCATGACGATCCAGCAGCGCCTCATCCTGAACGACAAGGAGCAGG
AGGACCTGACCATTCTCCAGTCGATTCAGTACTTGCGCGAAAAGGGGCTCATGAAGCCGGCGCCCCAGGCACAGA
CGAGCAGCGACAAGAACAAGGCCGACAAGAGCCGCGTCTTGAGAGCGGAGAGGCCGCAGAAGCCAGTGGCCGCCG
TGTCGAGCCTGCTGCCGGCCGCCCCGGCCTCACTTCCGGATCCGCCGATCAAGAGGGAGGCCGGCTCCGGCCGTC
GGAACGCGCCGTCATCCGCCGCGAGTTCGGGACTGGAACACTACCAGGGCTGGCTGTTGCAGCCGTACGGCAGCA
CCGACGGGAAGCAGGCCATGACCGATGACTTGCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail