Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06407
Gene name
Locationscaffold_07:2288632..2290455
Strand+
Gene length (bp)1823
Transcript length (bp)1758
Coding sequence length (bp)1758
Protein length (aa) 586

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03155 Alg6_Alg8 ALG6, ALG8 glycosyltransferase family 1.1E-78 63 291
PF03155 Alg6_Alg8 ALG6, ALG8 glycosyltransferase family 9.9E-48 334 563

GO

GO Term Description Terminal node
GO:0016758 hexosyltransferase activity Yes
GO:0016757 glycosyltransferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.5

Transmembrane Domains

Domain # Start End Length
1 51 73 22
2 151 173 22
3 180 202 22
4 207 226 19
5 233 255 22
6 270 292 22
7 405 424 19
8 473 495 22
9 508 530 22
10 543 565 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06407
MATASPSTRKPRRKPRRPPGPDGAGALIRAPSFVLAAFLWPARCASSQWEVLPLVLLSVGLFRWAAGLWGYSGLE
SPPMYGDYEAQRHWMELTTNLPVSQWYFHHLQWWGLDYPPLTAYHSWLMGKFGALINPAWFALFTSRGSDDPDLK
IFMRASVIVSEYLIYMPAAVVFVRRFARLNGVVSWTSSIALVAFLMQPATILIDHVHFQYNTVMLGLVVASMNSM
LAERYKSAALFFVAALGFKQMALYYALTVFSYLLSKCLLPTPNLTRLVSVALITLLSLAALILPLVLGTLYDRYR
GIDLWPDVDVRPPLPLFPSLGNYLDDRSVSYAIVEQLLQIIHRVFPFARGLFEDKVANFWCAANVVVKLRDLPPA
TLQKASLAATLISILPPNIILFFRPRKTTLPLAFAATAWGFFLFSYQVHEKSVLLPLMPMTLLLAGRHGLSGEVR
AWVGFANLLGAWTLFPLLHRVSLGVPYAVLTLLWAYLLGLPPFSWDAVWGASDGRSGLVRWATILIHGVFYGAMG
LWHILDASFRPPLDKPDLWVMANVGIGATGFGICYLWCLLRLAQESDLLPKGRTGKSKRS*
Coding >Ophcf2|06407
ATGGCTACAGCGAGCCCATCGACGCGCAAGCCCCGGCGTAAACCTCGACGGCCACCCGGTCCCGACGGCGCCGGA
GCTTTGATCCGCGCGCCGTCGTTCGTGCTGGCCGCCTTTCTCTGGCCCGCGCGCTGCGCTTCTTCGCAGTGGGAG
GTGTTGCCTCTTGTGCTCTTATCTGTAGGCCTGTTCCGCTGGGCGGCTGGTCTTTGGGGCTACTCTGGCTTGGAG
TCGCCACCCATGTATGGCGATTATGAAGCACAGCGTCACTGGATGGAGTTGACGACTAATCTACCCGTTTCGCAA
TGGTACTTTCACCATCTTCAGTGGTGGGGACTCGACTATCCGCCCCTGACGGCCTATCATAGCTGGCTGATGGGT
AAGTTTGGTGCCTTGATCAACCCAGCATGGTTCGCCCTCTTCACTTCGCGCGGATCCGACGACCCGGATCTCAAG
ATATTCATGAGAGCCTCCGTCATCGTCTCCGAGTATCTCATCTATATGCCCGCCGCCGTCGTCTTCGTTCGTCGC
TTCGCCCGGCTGAACGGCGTCGTCTCCTGGACGAGTTCCATTGCCCTCGTCGCCTTTCTCATGCAGCCGGCCACT
ATTCTCATTGATCATGTTCATTTTCAGTACAACACCGTCATGCTCGGTCTCGTCGTTGCCAGCATGAACAGCATG
CTAGCGGAGAGGTATAAAAGCGCCGCCTTGTTTTTCGTCGCTGCTCTTGGCTTCAAGCAGATGGCCCTCTACTAT
GCCTTGACCGTCTTCTCATACCTCTTGTCCAAGTGCCTGCTTCCCACACCTAACCTGACGAGACTGGTTTCCGTC
GCCCTCATCACTCTATTATCCTTGGCCGCCTTGATTCTCCCTCTCGTCTTGGGAACCCTGTATGACAGATACCGA
GGCATCGACTTATGGCCCGACGTGGACGTTCGCCCTCCGCTGCCGCTTTTCCCCTCGCTCGGAAACTACCTCGAT
GATCGGTCCGTCTCCTACGCCATCGTCGAGCAACTGCTTCAGATTATCCATCGCGTCTTTCCCTTCGCAAGAGGC
CTGTTCGAGGACAAGGTAGCCAATTTCTGGTGCGCCGCCAACGTCGTCGTCAAGCTCCGCGACCTCCCCCCCGCG
ACGCTGCAAAAGGCATCGCTGGCCGCCACGCTCATCTCCATCCTACCGCCCAACATCATCCTATTCTTTCGGCCG
CGGAAGACGACGCTACCTCTGGCTTTTGCCGCCACGGCATGGGGATTCTTTCTCTTCAGCTATCAGGTCCACGAG
AAGAGCGTCCTGCTGCCTTTGATGCCCATGACGCTCCTACTCGCCGGGAGGCACGGCCTCAGCGGAGAGGTGCGT
GCTTGGGTGGGCTTCGCCAACCTGCTGGGGGCGTGGACGCTGTTTCCATTGCTGCATCGCGTCAGTCTGGGCGTG
CCATACGCCGTCTTGACCCTTCTTTGGGCCTATCTGCTCGGCCTCCCGCCCTTTTCGTGGGACGCTGTATGGGGA
GCGTCGGACGGGCGGTCGGGGTTGGTCCGATGGGCGACGATTCTGATACACGGGGTCTTTTACGGTGCCATGGGG
CTGTGGCATATCCTCGACGCCTCGTTTCGCCCGCCGCTCGACAAGCCGGATCTATGGGTCATGGCAAACGTCGGA
ATCGGTGCTACAGGTTTCGGCATCTGCTACCTCTGGTGTCTGTTGAGGCTGGCGCAAGAAAGCGACCTCTTGCCC
AAGGGGCGGACGGGCAAGTCCAAGAGGAGTTGA
Transcript >Ophcf2|06407
ATGGCTACAGCGAGCCCATCGACGCGCAAGCCCCGGCGTAAACCTCGACGGCCACCCGGTCCCGACGGCGCCGGA
GCTTTGATCCGCGCGCCGTCGTTCGTGCTGGCCGCCTTTCTCTGGCCCGCGCGCTGCGCTTCTTCGCAGTGGGAG
GTGTTGCCTCTTGTGCTCTTATCTGTAGGCCTGTTCCGCTGGGCGGCTGGTCTTTGGGGCTACTCTGGCTTGGAG
TCGCCACCCATGTATGGCGATTATGAAGCACAGCGTCACTGGATGGAGTTGACGACTAATCTACCCGTTTCGCAA
TGGTACTTTCACCATCTTCAGTGGTGGGGACTCGACTATCCGCCCCTGACGGCCTATCATAGCTGGCTGATGGGT
AAGTTTGGTGCCTTGATCAACCCAGCATGGTTCGCCCTCTTCACTTCGCGCGGATCCGACGACCCGGATCTCAAG
ATATTCATGAGAGCCTCCGTCATCGTCTCCGAGTATCTCATCTATATGCCCGCCGCCGTCGTCTTCGTTCGTCGC
TTCGCCCGGCTGAACGGCGTCGTCTCCTGGACGAGTTCCATTGCCCTCGTCGCCTTTCTCATGCAGCCGGCCACT
ATTCTCATTGATCATGTTCATTTTCAGTACAACACCGTCATGCTCGGTCTCGTCGTTGCCAGCATGAACAGCATG
CTAGCGGAGAGGTATAAAAGCGCCGCCTTGTTTTTCGTCGCTGCTCTTGGCTTCAAGCAGATGGCCCTCTACTAT
GCCTTGACCGTCTTCTCATACCTCTTGTCCAAGTGCCTGCTTCCCACACCTAACCTGACGAGACTGGTTTCCGTC
GCCCTCATCACTCTATTATCCTTGGCCGCCTTGATTCTCCCTCTCGTCTTGGGAACCCTGTATGACAGATACCGA
GGCATCGACTTATGGCCCGACGTGGACGTTCGCCCTCCGCTGCCGCTTTTCCCCTCGCTCGGAAACTACCTCGAT
GATCGGTCCGTCTCCTACGCCATCGTCGAGCAACTGCTTCAGATTATCCATCGCGTCTTTCCCTTCGCAAGAGGC
CTGTTCGAGGACAAGGTAGCCAATTTCTGGTGCGCCGCCAACGTCGTCGTCAAGCTCCGCGACCTCCCCCCCGCG
ACGCTGCAAAAGGCATCGCTGGCCGCCACGCTCATCTCCATCCTACCGCCCAACATCATCCTATTCTTTCGGCCG
CGGAAGACGACGCTACCTCTGGCTTTTGCCGCCACGGCATGGGGATTCTTTCTCTTCAGCTATCAGGTCCACGAG
AAGAGCGTCCTGCTGCCTTTGATGCCCATGACGCTCCTACTCGCCGGGAGGCACGGCCTCAGCGGAGAGGTGCGT
GCTTGGGTGGGCTTCGCCAACCTGCTGGGGGCGTGGACGCTGTTTCCATTGCTGCATCGCGTCAGTCTGGGCGTG
CCATACGCCGTCTTGACCCTTCTTTGGGCCTATCTGCTCGGCCTCCCGCCCTTTTCGTGGGACGCTGTATGGGGA
GCGTCGGACGGGCGGTCGGGGTTGGTCCGATGGGCGACGATTCTGATACACGGGGTCTTTTACGGTGCCATGGGG
CTGTGGCATATCCTCGACGCCTCGTTTCGCCCGCCGCTCGACAAGCCGGATCTATGGGTCATGGCAAACGTCGGA
ATCGGTGCTACAGGTTTCGGCATCTGCTACCTCTGGTGTCTGTTGAGGCTGGCGCAAGAAAGCGACCTCTTGCCC
AAGGGGCGGACGGGCAAGTCCAAGAGGAGTTGA
Gene >Ophcf2|06407
ATGGCTACAGCGAGCCCATCGACGCGCAAGCCCCGGCGTAAACCTCGACGGCCACCCGGTCCCGACGGCGCCGGA
GCTTTGATCCGCGCGCCGTCGTTCGTGCTGGCCGCCTTTCTCTGGCCCGCGCGCTGCGCTTCTTCGCAGTGGGAG
GTGTTGCCTCTTGTGCTCTTATCTGTAGGCCTGTTCCGCTGGGCGGCTGGTCTTTGGGGCTACTCTGGTGAATAT
TCGCCGCGGTTTCTCGCGCTTGCTGGGGCTGACGATGCCGTCCTTTGGGTTGGGTAGGCTTGGAGTCGCCACCCA
TGTATGGCGATTATGAAGCACAGCGTCACTGGATGGAGTTGACGACTAATCTACCCGTTTCGCAATGGTACTTTC
ACCATCTTCAGTGGTGGGGACTCGACTATCCGCCCCTGACGGCCTATCATAGCTGGCTGATGGGTAAGTTTGGTG
CCTTGATCAACCCAGCATGGTTCGCCCTCTTCACTTCGCGCGGATCCGACGACCCGGATCTCAAGATATTCATGA
GAGCCTCCGTCATCGTCTCCGAGTATCTCATCTATATGCCCGCCGCCGTCGTCTTCGTTCGTCGCTTCGCCCGGC
TGAACGGCGTCGTCTCCTGGACGAGTTCCATTGCCCTCGTCGCCTTTCTCATGCAGCCGGCCACTATTCTCATTG
ATCATGTTCATTTTCAGTACAACACCGTCATGCTCGGTCTCGTCGTTGCCAGCATGAACAGCATGCTAGCGGAGA
GGTATAAAAGCGCCGCCTTGTTTTTCGTCGCTGCTCTTGGCTTCAAGCAGATGGCCCTCTACTATGCCTTGACCG
TCTTCTCATACCTCTTGTCCAAGTGCCTGCTTCCCACACCTAACCTGACGAGACTGGTTTCCGTCGCCCTCATCA
CTCTATTATCCTTGGCCGCCTTGATTCTCCCTCTCGTCTTGGGAACCCTGTATGACAGATACCGAGGCATCGACT
TATGGCCCGACGTGGACGTTCGCCCTCCGCTGCCGCTTTTCCCCTCGCTCGGAAACTACCTCGATGATCGGTCCG
TCTCCTACGCCATCGTCGAGCAACTGCTTCAGATTATCCATCGCGTCTTTCCCTTCGCAAGAGGCCTGTTCGAGG
ACAAGGTAGCCAATTTCTGGTGCGCCGCCAACGTCGTCGTCAAGCTCCGCGACCTCCCCCCCGCGACGCTGCAAA
AGGCATCGCTGGCCGCCACGCTCATCTCCATCCTACCGCCCAACATCATCCTATTCTTTCGGCCGCGGAAGACGA
CGCTACCTCTGGCTTTTGCCGCCACGGCATGGGGATTCTTTCTCTTCAGCTATCAGGTCCACGAGAAGAGCGTCC
TGCTGCCTTTGATGCCCATGACGCTCCTACTCGCCGGGAGGCACGGCCTCAGCGGAGAGGTGCGTGCTTGGGTGG
GCTTCGCCAACCTGCTGGGGGCGTGGACGCTGTTTCCATTGCTGCATCGCGTCAGTCTGGGCGTGCCATACGCCG
TCTTGACCCTTCTTTGGGCCTATCTGCTCGGCCTCCCGCCCTTTTCGTGGGACGCTGTATGGGGAGCGTCGGACG
GGCGGTCGGGGTTGGTCCGATGGGCGACGATTCTGATACACGGGGTCTTTTACGGTGCCATGGGGCTGTGGCATA
TCCTCGACGCCTCGTTTCGCCCGCCGCTCGACAAGCCGGATCTATGGGTCATGGCAAACGTCGGAATCGGTGCTA
CAGGTTTCGGCATCTGCTACCTCTGGTGTCTGTTGAGGCTGGCGCAAGAAAGCGACCTCTTGCCCAAGGGGCGGA
CGGGCAAGTCCAAGAGGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail