Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06404
Gene name
Locationscaffold_07:2283409..2284349
Strand+
Gene length (bp)940
Transcript length (bp)831
Coding sequence length (bp)831
Protein length (aa) 277

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain 7.9E-34 44 150
PF13534 Fer4_17 4Fe-4S dicluster domain 1.3E-09 187 260
PF13237 Fer4_10 4Fe-4S dicluster domain 4.5E-08 187 256
PF13183 Fer4_8 4Fe-4S dicluster domain 1.9E-07 185 258

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0009055 electron transfer activity Yes
GO:0003824 catalytic activity No
GO:0051540 metal cluster binding No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1511 0.1079 0.0235 0.0983 0.935 0.0495 0.0545 0.0604 0.0981 0.0107

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3836
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1436
Ophiocordyceps australis map64 (Brazil) OphauB2|6038
Ophiocordyceps camponoti-floridani Ophcf2|06404 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3484
Ophiocordyceps kimflemingae Ophio5|6405
Ophiocordyceps subramaniannii Hirsu2|7545

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06404
MAALCSPSRVLARTMLRSGAISVRSLATVSDVPQQQQQQPRMKTFQVYRWNPDAPDEKPRMQSYSIDLNKTGPMV
LDALVRIKNELDPTLTFRRSCREGICGSCAMNINGQNTLACLCRIPTESSSEVKLYPLPHTYVVKDLVPDLTHFY
KQYKSIKPYLQRETPAPDGKEYRQSKEDRRKLDGLYECILCACCSTSCPSYWWNAQEYLGPAILLQSFRWLADSR
DERKAERKTNLENSMSLYRCHTILNCTRACPKGLNPGKAIAEVKKEMAFGA*
Coding >Ophcf2|06404
ATGGCCGCCCTTTGTTCCCCCTCCCGAGTCCTGGCGCGGACGATGCTCCGGTCCGGAGCCATTTCCGTTCGCTCG
CTGGCTACCGTCAGCGATGTGCCTCAGCAGCAGCAGCAGCAGCCTCGGATGAAGACATTTCAGGTTTACCGATGG
AACCCGGACGCGCCGGACGAGAAGCCGCGGATGCAGTCGTACTCGATTGACCTCAACAAGACGGGGCCCATGGTG
CTGGACGCCCTGGTGCGCATCAAGAATGAGCTGGATCCTACTTTGACCTTTCGTCGGAGTTGTCGGGAGGGCATC
TGCGGTAGCTGTGCCATGAACATCAATGGCCAGAATACGCTGGCCTGCTTGTGCCGGATTCCTACAGAATCGTCC
TCAGAGGTCAAGCTCTACCCGTTACCGCACACGTACGTCGTCAAGGACCTGGTGCCCGACTTGACGCACTTCTAC
AAGCAATACAAGTCCATCAAGCCCTACCTACAGCGCGAGACGCCCGCGCCCGACGGCAAAGAGTATCGGCAGTCA
AAGGAGGACCGGCGGAAGCTAGACGGCCTGTACGAATGTATCCTCTGCGCATGCTGCTCGACATCGTGTCCGTCG
TACTGGTGGAACGCGCAAGAGTACCTCGGGCCCGCCATCCTGCTTCAGTCGTTCCGCTGGCTGGCCGACTCGCGC
GATGAGCGCAAGGCAGAGCGCAAGACGAACCTGGAGAACTCGATGAGTCTATACCGCTGCCATACCATCCTCAAC
TGCACCCGCGCCTGTCCCAAGGGCCTAAACCCGGGCAAGGCCATTGCCGAGGTGAAGAAGGAGATGGCCTTTGGC
GCGTGA
Transcript >Ophcf2|06404
ATGGCCGCCCTTTGTTCCCCCTCCCGAGTCCTGGCGCGGACGATGCTCCGGTCCGGAGCCATTTCCGTTCGCTCG
CTGGCTACCGTCAGCGATGTGCCTCAGCAGCAGCAGCAGCAGCCTCGGATGAAGACATTTCAGGTTTACCGATGG
AACCCGGACGCGCCGGACGAGAAGCCGCGGATGCAGTCGTACTCGATTGACCTCAACAAGACGGGGCCCATGGTG
CTGGACGCCCTGGTGCGCATCAAGAATGAGCTGGATCCTACTTTGACCTTTCGTCGGAGTTGTCGGGAGGGCATC
TGCGGTAGCTGTGCCATGAACATCAATGGCCAGAATACGCTGGCCTGCTTGTGCCGGATTCCTACAGAATCGTCC
TCAGAGGTCAAGCTCTACCCGTTACCGCACACGTACGTCGTCAAGGACCTGGTGCCCGACTTGACGCACTTCTAC
AAGCAATACAAGTCCATCAAGCCCTACCTACAGCGCGAGACGCCCGCGCCCGACGGCAAAGAGTATCGGCAGTCA
AAGGAGGACCGGCGGAAGCTAGACGGCCTGTACGAATGTATCCTCTGCGCATGCTGCTCGACATCGTGTCCGTCG
TACTGGTGGAACGCGCAAGAGTACCTCGGGCCCGCCATCCTGCTTCAGTCGTTCCGCTGGCTGGCCGACTCGCGC
GATGAGCGCAAGGCAGAGCGCAAGACGAACCTGGAGAACTCGATGAGTCTATACCGCTGCCATACCATCCTCAAC
TGCACCCGCGCCTGTCCCAAGGGCCTAAACCCGGGCAAGGCCATTGCCGAGGTGAAGAAGGAGATGGCCTTTGGC
GCGTGA
Gene >Ophcf2|06404
ATGGCCGCCCTTTGTTCCCCCTCCCGAGTCCTGGCGCGGACGATGCTCCGGTCCGGAGCCATTTCCGTTCGCTCG
CTGGCTACCGTCAGCGATGTGCCTCAGCAGCAGCAGCAGCAGCCTCGGATGAAGACATTTCAGGTTTACCGATGG
AACCCGGACGCGCCGGACGAGAAGCCGCGGATGCAGTCGTACTCGATTGACCTCAACAAGACGGGGCCCATGGTG
CTGGACGCCCTGGTGCGCATCAAGAATGAGCTGGATCCTACTTTGACCTTTCGTCGGAGTTGTCGGGAGGGCATC
TGCGGTAGCTGTGCCATGAACATCAATGGCCAGAATACGCTGGCCTGCTTGTGTATGTGCCTTTTGCGACGTTGG
GCAGATTGATCGTCTTCTCACACTTGTCACAGGCCGGATTCCTACAGAATCGTCCTCAGAGGTCAAGCTCTACCC
GTTACCGCACACGTACGTCGTCAAGGACCTGGTGCCCGACTTGACGCACTTCTACAAGCAATACAAGTCCATCAA
GCCCTACCTACAGCGCGAGACGCCCGCGCCCGACGTACGCTGCCATTAGACATGTTGAATGAAGTGATCTCGGCT
GACGTTGACGCAGGGCAAAGAGTATCGGCAGTCAAAGGAGGACCGGCGGAAGCTAGACGGCCTGTACGAATGTAT
CCTCTGCGCATGCTGCTCGACATCGTGTCCGTCGTACTGGTGGAACGCGCAAGAGTACCTCGGGCCCGCCATCCT
GCTTCAGTCGTTCCGCTGGCTGGCCGACTCGCGCGATGAGCGCAAGGCAGAGCGCAAGACGAACCTGGAGAACTC
GATGAGTCTATACCGCTGCCATACCATCCTCAACTGCACCCGCGCCTGTCCCAAGGGCCTAAACCCGGGCAAGGC
CATTGCCGAGGTGAAGAAGGAGATGGCCTTTGGCGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail