Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06396
Gene name
Locationscaffold_07:2265470..2270667
Strand+
Gene length (bp)5197
Transcript length (bp)5022
Coding sequence length (bp)5022
Protein length (aa) 1674

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00637 Clathrin Region in Clathrin and VPS 1.7E-23 545 684
PF00637 Clathrin Region in Clathrin and VPS 1.4E-21 695 832
PF00637 Clathrin Region in Clathrin and VPS 1.5E-28 843 970
PF00637 Clathrin Region in Clathrin and VPS 3.7E-28 987 1126
PF00637 Clathrin Region in Clathrin and VPS 1.8E-30 1136 1274
PF00637 Clathrin Region in Clathrin and VPS 5.7E-31 1281 1425
PF00637 Clathrin Region in Clathrin and VPS 1.1E-31 1432 1572
PF13838 Clathrin_H_link Clathrin-H-link 2.5E-29 358 423
PF01394 Clathrin_propel Clathrin propeller repeat 1.2E-07 152 190

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0016192 vesicle-mediated transport Yes
GO:0051234 establishment of localization No
GO:0051641 cellular localization No
GO:0070727 cellular macromolecule localization No
GO:0045184 establishment of protein localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0033036 macromolecule localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0071705 nitrogen compound transport No
GO:0046907 intracellular transport No
GO:0071702 organic substance transport No
GO:0008104 protein localization No
GO:0015031 protein transport No
GO:0051179 localization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.5879 0.4681 0.0487 0.1396 0.0496 0.0046 0.2379 0.3381 0.2115 0.0008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1635
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3463
Ophiocordyceps australis map64 (Brazil) OphauB2|6048
Ophiocordyceps camponoti-floridani Ophcf2|06396 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3479
Ophiocordyceps kimflemingae Ophio5|4664
Ophiocordyceps subramaniannii Hirsu2|131

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06396
MAPLPIEFRELVQLANVGVDAQAIGFNSCTLESDSFVCIREKKGDSSEVVIVELKNGNNVSRKPIKADNAIMHWN
RQIIALKAQQSRVLQIFDLVERKRLKSCNMTEDVQFWKWISESTLGLVTTSSVYHWDVYDASQESPSKVFERNAN
LNGCQIINYRANEDSKWMVVVGISSQGGRVVGAMQLYSKERGISQAIEGHAAAFGSLRLEGASQDSKVFSFAVRT
AAGAKLHIVEVDHPEGNPAFPKKSVDIFFPETAPNDFPVALQIAHKYGVIFMATKYGFIHVYDLETGTPIYMNRI
SSETIFTSCLDDESSGLVSINRKGQVLFVSIDDNTVIPYLLENPANSQIAIKLASRAGLAGADNLYATQFDQLFK
SGNYMEAAKVAANSPRGFLRTAETIEKFKRLPQNPGQMAWTLQYFGLLLDKGTLNRQETIELASPVLQQNRKHLL
DKWFKEGKLDCSEQLGDMVRPYDVNMALTIYLKANVPQKVVAGLAETGQFDKILPYAAQTGFQPDYIQLLQHIIR
TNPEKGSEFATALANSDQGPLVDFERVCDIFQSQGLIQEATAFLLEALKENKPEHARLQTRLLEMNLMHAPQVAD
AILGNDMFTHFDKPRIAQLCENAGLMQKAMELHEDPEAIKRVIVNIAGSPNFNAEWLTNYFGKLSVEQSLDCLDA
MMKHNIRQNLQSVVNIATKYSELLGPVRLIDLFEKYKTAEGLFYYLGSIVNLTDDPDVHFKYIEAATVSQQFNEV
ERICRDSSHYNPEKVKNFLKEAKLPEQLPLIIVCDRFNFVHDLILYLYQNQQFQAIESYVQRVNPSRTPAVVGGL
LDVDCDESIIKQLLTTVNAQQINIDELVSEVESRNRLKLLLPFLESALQTGAQPQAVYNALAKIYIDSNNNPEKF
LKENDQYDTLTIGKYCEKRDPNLAFIAYSKGQNDLELVNITNENSMYRAQARHLLERSDNDLWRFVLSENNIHRR
SVVDQVIATAVPESTDPAKVSVAVSAFLENDLPLELIELLEKIVLEPSPFSDNQSLQNLLMFTAAKADKARVMDY
IHKLDAYNADEIATACIEVGLFEEAFEVYKKADNKTAAVDVLVENVVSIDRSQAYAEEVDLPEVWSRVAKAQLDG
LRVPDAIESYIKAEDPKNHEEVIEIATSAGKNEELVKYLRMARKTMREPAIDTALAFCYARLDQLPDLEDFLRGT
NVANVEESGDKAYEEGFFEASKIFYTSISNWAKLATTLVHLDDYQAAVDCARKANNIKVWKQVHEACVEKREFRL
AQICGLNLIVDAEQLQTLVKEYERNGYFDELINLLEQGLGLERAHMGMFTELGIALSKYHPERLMEHIKLFWSRM
NMPKMIRACEEANLWPELVFCYCHYDEFDNAALAVIERPENSWEHQQFKEILVKVANLEIYYRGIRFYVEQHPSL
LTDLLAALTPRIDVNRVVKMFQKNDSLPLIKPFLLNVQSQNKRIVNEAVNDLLIEEEDYKTLRDSVHNYDNYDAV
GLASRLEKHDLIFFRQIAANIYRKNKRWEKSITLSKQDKLFKDAIETAATSGKAEVVEDLVRYFVDIGHRECYTG
MLYACNDLVRPDLVLELSWRNGLMDFSMPYMVNMLAQQTREIALLKSDNEARKSKEKEQEKTEDNKPILGGSRLM
ITAGPTGGSVMGGGGGMMGAEAA*
Coding >Ophcf2|06396
ATGGCGCCTTTGCCCATCGAGTTTCGTGAGCTGGTTCAGCTTGCCAACGTTGGTGTCGATGCGCAGGCTATCGGC
TTCAACTCTTGTACACTCGAATCCGACTCGTTCGTGTGCATTCGAGAGAAGAAGGGAGACTCGTCCGAGGTCGTC
ATCGTCGAGCTCAAAAATGGCAACAATGTCTCTCGCAAGCCCATCAAGGCCGACAATGCCATCATGCACTGGAAT
CGTCAGATCATCGCCCTCAAGGCTCAGCAGTCGCGAGTCTTGCAGATCTTCGACCTGGTGGAGAGAAAAAGGCTC
AAGTCGTGCAATATGACCGAGGATGTTCAATTCTGGAAGTGGATCAGCGAATCCACCTTGGGCCTCGTCACCACC
TCGAGCGTCTATCACTGGGACGTCTACGATGCGTCCCAGGAGTCGCCCTCGAAAGTATTTGAGCGCAATGCTAAC
CTCAATGGCTGCCAAATTATCAACTACCGCGCCAATGAGGATAGCAAGTGGATGGTGGTCGTCGGCATATCTTCC
CAGGGAGGTCGCGTTGTTGGAGCTATGCAGTTGTATTCCAAAGAGCGCGGCATCAGCCAAGCCATCGAGGGTCAC
GCCGCTGCTTTTGGCTCTTTGAGGCTCGAGGGCGCTTCTCAAGACTCAAAGGTCTTCAGCTTCGCTGTCCGAACC
GCCGCCGGTGCCAAGCTGCACATTGTCGAGGTCGATCACCCGGAAGGCAACCCCGCCTTTCCCAAGAAAAGCGTC
GACATCTTCTTCCCAGAAACTGCACCCAACGACTTCCCCGTCGCCCTGCAAATCGCTCACAAGTACGGCGTCATC
TTCATGGCGACCAAGTACGGCTTCATCCACGTCTATGATCTCGAGACGGGAACGCCCATCTACATGAACCGAATC
TCGAGCGAGACCATCTTCACCAGCTGCCTCGACGACGAGTCATCGGGCCTCGTCAGCATCAACCGCAAGGGTCAG
GTTCTCTTCGTCTCCATCGACGACAACACCGTCATCCCGTACCTCCTCGAGAACCCGGCCAACAGCCAGATCGCC
ATCAAGCTGGCTTCCAGAGCCGGCCTCGCGGGTGCCGACAACCTCTACGCCACGCAGTTTGATCAGCTCTTCAAG
TCCGGAAACTACATGGAAGCCGCCAAGGTGGCGGCCAACTCGCCCCGTGGGTTCCTCCGCACCGCCGAGACGATA
GAAAAGTTCAAGCGGCTGCCGCAGAATCCCGGTCAGATGGCCTGGACCCTGCAGTACTTCGGCTTGCTCCTCGAC
AAGGGCACCCTGAACCGTCAGGAGACCATCGAGCTCGCCAGCCCCGTGCTGCAGCAGAACCGGAAGCATCTGCTG
GACAAGTGGTTCAAGGAGGGCAAGCTCGACTGCTCGGAGCAGCTGGGCGACATGGTTCGACCGTACGACGTCAAC
ATGGCCCTCACCATCTACCTCAAGGCCAACGTGCCCCAAAAAGTCGTGGCCGGCCTCGCTGAGACGGGTCAGTTT
GATAAGATCCTCCCCTACGCAGCCCAGACCGGCTTCCAGCCCGACTACATCCAGCTCCTGCAGCACATCATCCGG
ACCAACCCGGAGAAGGGCAGCGAGTTCGCCACGGCGCTCGCGAACAGCGACCAGGGCCCGCTCGTCGACTTCGAG
CGCGTCTGCGACATCTTCCAGTCGCAGGGCCTGATACAGGAGGCTACGGCCTTTTTGCTAGAGGCCCTCAAGGAG
AACAAGCCGGAGCACGCCCGTCTACAGACGCGCCTCCTCGAGATGAACCTCATGCACGCGCCCCAGGTGGCCGAC
GCCATCCTCGGCAACGACATGTTCACCCACTTTGACAAGCCGCGCATCGCCCAGCTGTGCGAGAACGCCGGCCTG
ATGCAAAAGGCCATGGAGCTGCACGAAGACCCCGAGGCCATCAAGCGCGTCATCGTCAACATTGCCGGCAGCCCA
AACTTCAACGCCGAGTGGCTCACCAACTACTTTGGCAAGCTGTCGGTGGAGCAGTCGCTCGATTGCCTCGACGCC
ATGATGAAGCACAACATCCGCCAAAACTTGCAGTCGGTCGTTAACATCGCCACCAAGTACTCGGAGCTTCTGGGG
CCTGTCCGCCTCATCGACCTGTTTGAGAAGTACAAGACGGCCGAGGGTCTCTTCTACTACCTTGGCAGCATCGTC
AACCTGACGGACGACCCGGACGTGCACTTCAAGTACATCGAGGCCGCCACCGTGTCGCAGCAGTTCAACGAGGTG
GAGCGCATCTGCCGGGACAGCAGCCACTACAACCCGGAAAAGGTCAAGAACTTCCTCAAGGAAGCCAAGCTGCCC
GAGCAACTGCCGCTCATCATCGTGTGCGACCGGTTCAACTTTGTGCACGACCTGATTCTGTACCTCTATCAGAAT
CAGCAGTTCCAGGCCATCGAGTCCTACGTCCAGCGCGTCAATCCGTCGAGGACGCCGGCGGTCGTCGGCGGCCTC
CTCGACGTCGACTGCGACGAGAGCATCATCAAGCAGCTGCTGACGACGGTCAACGCCCAGCAGATCAATATTGAC
GAGCTGGTGTCCGAGGTGGAGTCGCGCAACCGGCTCAAGCTGTTGCTGCCCTTCCTCGAGTCGGCGCTTCAGACG
GGAGCCCAGCCGCAGGCGGTCTACAACGCGCTGGCCAAGATTTACATCGACTCCAACAACAACCCGGAAAAGTTC
CTCAAGGAGAACGACCAATACGACACGCTGACGATCGGAAAGTACTGCGAGAAGCGAGACCCCAATCTGGCCTTT
ATCGCCTACTCCAAGGGCCAGAACGACCTGGAGCTCGTCAACATCACCAACGAGAACTCGATGTACCGGGCTCAG
GCCCGTCACCTGCTTGAGCGGTCCGACAACGACCTCTGGCGCTTCGTCCTCAGCGAGAACAACATCCACCGACGC
TCCGTCGTCGACCAGGTCATCGCCACGGCCGTGCCCGAGTCGACGGACCCGGCCAAGGTGTCGGTCGCGGTCTCG
GCCTTTCTCGAGAATGACTTGCCCCTGGAGCTTATTGAGCTGCTGGAGAAGATTGTTCTCGAGCCCTCGCCGTTT
AGCGACAACCAGAGCCTGCAGAACCTGTTGATGTTCACGGCGGCCAAGGCCGACAAGGCGCGCGTCATGGACTAC
ATCCACAAGCTCGACGCCTACAACGCCGACGAGATTGCCACGGCGTGCATCGAGGTCGGCCTGTTCGAGGAGGCC
TTTGAGGTCTACAAAAAGGCCGACAACAAGACGGCGGCCGTCGACGTGCTGGTGGAGAACGTTGTCAGCATCGAC
CGGTCCCAGGCGTACGCCGAGGAGGTTGACCTGCCCGAGGTCTGGAGTCGAGTGGCCAAGGCGCAGCTCGACGGC
CTCCGCGTGCCAGACGCCATCGAGTCGTACATCAAGGCCGAGGACCCCAAGAACCACGAGGAGGTGATTGAGATT
GCGACTTCGGCCGGCAAGAACGAGGAGCTCGTCAAGTACCTTCGCATGGCGCGCAAGACGATGCGGGAGCCCGCC
ATCGACACGGCCCTGGCCTTTTGCTACGCCCGCCTGGACCAGCTGCCGGACCTCGAGGACTTTTTGCGCGGCACA
AACGTGGCCAACGTGGAAGAGTCGGGAGATAAGGCGTACGAGGAGGGCTTCTTTGAGGCGTCCAAGATCTTCTAC
ACGAGCATCTCCAACTGGGCCAAGCTGGCGACGACGCTGGTGCACCTGGACGACTACCAGGCGGCCGTCGACTGC
GCGCGCAAGGCCAACAACATCAAGGTGTGGAAGCAGGTGCACGAGGCGTGCGTGGAGAAGAGGGAGTTCAGGCTG
GCGCAGATCTGCGGGCTGAACCTGATCGTGGACGCTGAGCAGCTGCAGACGCTGGTCAAGGAGTACGAGCGCAAC
GGCTACTTTGACGAGCTCATCAACCTGCTCGAACAGGGCCTCGGACTGGAGCGTGCGCACATGGGCATGTTTACC
GAGCTGGGCATCGCGCTGTCCAAGTACCACCCGGAGCGGCTGATGGAGCACATCAAGCTCTTCTGGTCCCGGATG
AACATGCCCAAGATGATTCGGGCGTGCGAGGAGGCCAACCTTTGGCCGGAGCTGGTGTTTTGCTACTGCCACTAC
GATGAGTTCGACAACGCGGCGCTGGCGGTCATTGAGAGGCCCGAGAACTCGTGGGAGCACCAGCAGTTCAAGGAG
ATTCTGGTCAAGGTGGCCAACCTCGAGATCTACTACCGCGGCATCCGGTTCTACGTGGAGCAGCACCCGTCGCTG
CTGACGGATCTGTTGGCGGCGCTGACACCGCGCATCGACGTCAACCGGGTGGTCAAGATGTTTCAGAAGAACGAC
AGCCTGCCGCTCATCAAGCCCTTCCTCCTCAACGTCCAGTCGCAAAACAAGCGCATCGTCAACGAGGCGGTCAAC
GACCTGCTGATCGAGGAGGAGGACTACAAGACGCTGCGCGACTCGGTGCACAACTACGACAACTACGACGCCGTG
GGGCTGGCGAGCCGGCTGGAGAAGCACGACCTCATCTTCTTCCGACAGATCGCGGCCAACATTTACCGCAAGAAC
AAGCGATGGGAGAAGTCGATTACGCTGTCGAAGCAGGACAAGCTGTTCAAGGACGCCATCGAGACGGCGGCGACG
TCAGGCAAGGCCGAGGTGGTGGAGGATCTGGTCCGATATTTTGTCGATATTGGCCACCGAGAATGCTACACCGGC
ATGCTGTACGCGTGCAACGACCTCGTACGGCCGGACCTGGTGCTGGAGCTGTCGTGGCGCAACGGCCTGATGGAC
TTTAGCATGCCTTATATGGTCAACATGCTGGCGCAGCAGACGAGGGAGATTGCGTTACTCAAGTCGGACAACGAG
GCGCGCAAGTCCAAGGAAAAGGAGCAGGAGAAGACGGAGGACAACAAGCCGATCCTGGGAGGGTCGCGGCTGATG
ATTACGGCCGGACCGACGGGGGGCAGCGTCATGGGGGGCGGAGGCGGCATGATGGGGGCGGAAGCGGCATGA
Transcript >Ophcf2|06396
ATGGCGCCTTTGCCCATCGAGTTTCGTGAGCTGGTTCAGCTTGCCAACGTTGGTGTCGATGCGCAGGCTATCGGC
TTCAACTCTTGTACACTCGAATCCGACTCGTTCGTGTGCATTCGAGAGAAGAAGGGAGACTCGTCCGAGGTCGTC
ATCGTCGAGCTCAAAAATGGCAACAATGTCTCTCGCAAGCCCATCAAGGCCGACAATGCCATCATGCACTGGAAT
CGTCAGATCATCGCCCTCAAGGCTCAGCAGTCGCGAGTCTTGCAGATCTTCGACCTGGTGGAGAGAAAAAGGCTC
AAGTCGTGCAATATGACCGAGGATGTTCAATTCTGGAAGTGGATCAGCGAATCCACCTTGGGCCTCGTCACCACC
TCGAGCGTCTATCACTGGGACGTCTACGATGCGTCCCAGGAGTCGCCCTCGAAAGTATTTGAGCGCAATGCTAAC
CTCAATGGCTGCCAAATTATCAACTACCGCGCCAATGAGGATAGCAAGTGGATGGTGGTCGTCGGCATATCTTCC
CAGGGAGGTCGCGTTGTTGGAGCTATGCAGTTGTATTCCAAAGAGCGCGGCATCAGCCAAGCCATCGAGGGTCAC
GCCGCTGCTTTTGGCTCTTTGAGGCTCGAGGGCGCTTCTCAAGACTCAAAGGTCTTCAGCTTCGCTGTCCGAACC
GCCGCCGGTGCCAAGCTGCACATTGTCGAGGTCGATCACCCGGAAGGCAACCCCGCCTTTCCCAAGAAAAGCGTC
GACATCTTCTTCCCAGAAACTGCACCCAACGACTTCCCCGTCGCCCTGCAAATCGCTCACAAGTACGGCGTCATC
TTCATGGCGACCAAGTACGGCTTCATCCACGTCTATGATCTCGAGACGGGAACGCCCATCTACATGAACCGAATC
TCGAGCGAGACCATCTTCACCAGCTGCCTCGACGACGAGTCATCGGGCCTCGTCAGCATCAACCGCAAGGGTCAG
GTTCTCTTCGTCTCCATCGACGACAACACCGTCATCCCGTACCTCCTCGAGAACCCGGCCAACAGCCAGATCGCC
ATCAAGCTGGCTTCCAGAGCCGGCCTCGCGGGTGCCGACAACCTCTACGCCACGCAGTTTGATCAGCTCTTCAAG
TCCGGAAACTACATGGAAGCCGCCAAGGTGGCGGCCAACTCGCCCCGTGGGTTCCTCCGCACCGCCGAGACGATA
GAAAAGTTCAAGCGGCTGCCGCAGAATCCCGGTCAGATGGCCTGGACCCTGCAGTACTTCGGCTTGCTCCTCGAC
AAGGGCACCCTGAACCGTCAGGAGACCATCGAGCTCGCCAGCCCCGTGCTGCAGCAGAACCGGAAGCATCTGCTG
GACAAGTGGTTCAAGGAGGGCAAGCTCGACTGCTCGGAGCAGCTGGGCGACATGGTTCGACCGTACGACGTCAAC
ATGGCCCTCACCATCTACCTCAAGGCCAACGTGCCCCAAAAAGTCGTGGCCGGCCTCGCTGAGACGGGTCAGTTT
GATAAGATCCTCCCCTACGCAGCCCAGACCGGCTTCCAGCCCGACTACATCCAGCTCCTGCAGCACATCATCCGG
ACCAACCCGGAGAAGGGCAGCGAGTTCGCCACGGCGCTCGCGAACAGCGACCAGGGCCCGCTCGTCGACTTCGAG
CGCGTCTGCGACATCTTCCAGTCGCAGGGCCTGATACAGGAGGCTACGGCCTTTTTGCTAGAGGCCCTCAAGGAG
AACAAGCCGGAGCACGCCCGTCTACAGACGCGCCTCCTCGAGATGAACCTCATGCACGCGCCCCAGGTGGCCGAC
GCCATCCTCGGCAACGACATGTTCACCCACTTTGACAAGCCGCGCATCGCCCAGCTGTGCGAGAACGCCGGCCTG
ATGCAAAAGGCCATGGAGCTGCACGAAGACCCCGAGGCCATCAAGCGCGTCATCGTCAACATTGCCGGCAGCCCA
AACTTCAACGCCGAGTGGCTCACCAACTACTTTGGCAAGCTGTCGGTGGAGCAGTCGCTCGATTGCCTCGACGCC
ATGATGAAGCACAACATCCGCCAAAACTTGCAGTCGGTCGTTAACATCGCCACCAAGTACTCGGAGCTTCTGGGG
CCTGTCCGCCTCATCGACCTGTTTGAGAAGTACAAGACGGCCGAGGGTCTCTTCTACTACCTTGGCAGCATCGTC
AACCTGACGGACGACCCGGACGTGCACTTCAAGTACATCGAGGCCGCCACCGTGTCGCAGCAGTTCAACGAGGTG
GAGCGCATCTGCCGGGACAGCAGCCACTACAACCCGGAAAAGGTCAAGAACTTCCTCAAGGAAGCCAAGCTGCCC
GAGCAACTGCCGCTCATCATCGTGTGCGACCGGTTCAACTTTGTGCACGACCTGATTCTGTACCTCTATCAGAAT
CAGCAGTTCCAGGCCATCGAGTCCTACGTCCAGCGCGTCAATCCGTCGAGGACGCCGGCGGTCGTCGGCGGCCTC
CTCGACGTCGACTGCGACGAGAGCATCATCAAGCAGCTGCTGACGACGGTCAACGCCCAGCAGATCAATATTGAC
GAGCTGGTGTCCGAGGTGGAGTCGCGCAACCGGCTCAAGCTGTTGCTGCCCTTCCTCGAGTCGGCGCTTCAGACG
GGAGCCCAGCCGCAGGCGGTCTACAACGCGCTGGCCAAGATTTACATCGACTCCAACAACAACCCGGAAAAGTTC
CTCAAGGAGAACGACCAATACGACACGCTGACGATCGGAAAGTACTGCGAGAAGCGAGACCCCAATCTGGCCTTT
ATCGCCTACTCCAAGGGCCAGAACGACCTGGAGCTCGTCAACATCACCAACGAGAACTCGATGTACCGGGCTCAG
GCCCGTCACCTGCTTGAGCGGTCCGACAACGACCTCTGGCGCTTCGTCCTCAGCGAGAACAACATCCACCGACGC
TCCGTCGTCGACCAGGTCATCGCCACGGCCGTGCCCGAGTCGACGGACCCGGCCAAGGTGTCGGTCGCGGTCTCG
GCCTTTCTCGAGAATGACTTGCCCCTGGAGCTTATTGAGCTGCTGGAGAAGATTGTTCTCGAGCCCTCGCCGTTT
AGCGACAACCAGAGCCTGCAGAACCTGTTGATGTTCACGGCGGCCAAGGCCGACAAGGCGCGCGTCATGGACTAC
ATCCACAAGCTCGACGCCTACAACGCCGACGAGATTGCCACGGCGTGCATCGAGGTCGGCCTGTTCGAGGAGGCC
TTTGAGGTCTACAAAAAGGCCGACAACAAGACGGCGGCCGTCGACGTGCTGGTGGAGAACGTTGTCAGCATCGAC
CGGTCCCAGGCGTACGCCGAGGAGGTTGACCTGCCCGAGGTCTGGAGTCGAGTGGCCAAGGCGCAGCTCGACGGC
CTCCGCGTGCCAGACGCCATCGAGTCGTACATCAAGGCCGAGGACCCCAAGAACCACGAGGAGGTGATTGAGATT
GCGACTTCGGCCGGCAAGAACGAGGAGCTCGTCAAGTACCTTCGCATGGCGCGCAAGACGATGCGGGAGCCCGCC
ATCGACACGGCCCTGGCCTTTTGCTACGCCCGCCTGGACCAGCTGCCGGACCTCGAGGACTTTTTGCGCGGCACA
AACGTGGCCAACGTGGAAGAGTCGGGAGATAAGGCGTACGAGGAGGGCTTCTTTGAGGCGTCCAAGATCTTCTAC
ACGAGCATCTCCAACTGGGCCAAGCTGGCGACGACGCTGGTGCACCTGGACGACTACCAGGCGGCCGTCGACTGC
GCGCGCAAGGCCAACAACATCAAGGTGTGGAAGCAGGTGCACGAGGCGTGCGTGGAGAAGAGGGAGTTCAGGCTG
GCGCAGATCTGCGGGCTGAACCTGATCGTGGACGCTGAGCAGCTGCAGACGCTGGTCAAGGAGTACGAGCGCAAC
GGCTACTTTGACGAGCTCATCAACCTGCTCGAACAGGGCCTCGGACTGGAGCGTGCGCACATGGGCATGTTTACC
GAGCTGGGCATCGCGCTGTCCAAGTACCACCCGGAGCGGCTGATGGAGCACATCAAGCTCTTCTGGTCCCGGATG
AACATGCCCAAGATGATTCGGGCGTGCGAGGAGGCCAACCTTTGGCCGGAGCTGGTGTTTTGCTACTGCCACTAC
GATGAGTTCGACAACGCGGCGCTGGCGGTCATTGAGAGGCCCGAGAACTCGTGGGAGCACCAGCAGTTCAAGGAG
ATTCTGGTCAAGGTGGCCAACCTCGAGATCTACTACCGCGGCATCCGGTTCTACGTGGAGCAGCACCCGTCGCTG
CTGACGGATCTGTTGGCGGCGCTGACACCGCGCATCGACGTCAACCGGGTGGTCAAGATGTTTCAGAAGAACGAC
AGCCTGCCGCTCATCAAGCCCTTCCTCCTCAACGTCCAGTCGCAAAACAAGCGCATCGTCAACGAGGCGGTCAAC
GACCTGCTGATCGAGGAGGAGGACTACAAGACGCTGCGCGACTCGGTGCACAACTACGACAACTACGACGCCGTG
GGGCTGGCGAGCCGGCTGGAGAAGCACGACCTCATCTTCTTCCGACAGATCGCGGCCAACATTTACCGCAAGAAC
AAGCGATGGGAGAAGTCGATTACGCTGTCGAAGCAGGACAAGCTGTTCAAGGACGCCATCGAGACGGCGGCGACG
TCAGGCAAGGCCGAGGTGGTGGAGGATCTGGTCCGATATTTTGTCGATATTGGCCACCGAGAATGCTACACCGGC
ATGCTGTACGCGTGCAACGACCTCGTACGGCCGGACCTGGTGCTGGAGCTGTCGTGGCGCAACGGCCTGATGGAC
TTTAGCATGCCTTATATGGTCAACATGCTGGCGCAGCAGACGAGGGAGATTGCGTTACTCAAGTCGGACAACGAG
GCGCGCAAGTCCAAGGAAAAGGAGCAGGAGAAGACGGAGGACAACAAGCCGATCCTGGGAGGGTCGCGGCTGATG
ATTACGGCCGGACCGACGGGGGGCAGCGTCATGGGGGGCGGAGGCGGCATGATGGGGGCGGAAGCGGCATGA
Gene >Ophcf2|06396
ATGGCGCCTTTGCCCATCGAGTTTCGTGAGCTGGTTCAGCTTGCCAACGTTGGTGTCGATGCGCAGGCTATCGGC
TTCAACTCTTGTGTGAGTGCTCAATTTTTTTCTTCTTTTCTACGTTTGCTAACTATATGTTGCCTAGACACTCGA
ATCCGACTCGTTCGTGTGCATTCGAGAGAAGAAGGGAGACTCGTCCGAGGTCGTCATCGTCGAGCTCAAAAATGG
CAACAATGTCTCTCGCAAGCCCATCAAGGCCGACAATGCCATCATGCACTGGAATCGTCAGATCATCGCCCTCAA
GGCTCAGCAGTCGCGAGTCTTGCAGATCTTCGACCTGGTGGAGAGAAAAAGGCTCAAGTCGTGCAATATGACCGA
GGATGTTCAATTCTGGAAGTGGATCAGCGAATCCACCTTGGGCCTCGTCACCACCTCGAGCGTCTATCACTGGGA
CGTCTACGATGCGTCCCAGGAGTCGCCCTCGAAAGTATTTGAGCGCAATGCTAACCTCAATGTTCGTTCCACCCC
CTGTCTCTTTGGTCGTTCGGGAACAAGTGACTGACTGAATTTCTTTCAGGGCTGCCAAATTATCAACTACCGCGC
CAATGAGGATAGCAAGTGGATGGTGGTCGTCGGCATATCTTCCCAGGGAGGTCGCGTTGTTGGAGCTATGCAGTT
GTATTCCAAAGAGCGCGGCATCAGCCAAGCCATCGAGGGTCACGCCGCTGCTTTTGGCTCTTTGAGGCTCGAGGG
CGCTTCTCAAGACTCAAAGGTCTTCAGCTTCGCTGTCCGAACCGCCGCCGGTGCCAAGCTGCACATTGTCGAGGT
CGATCACCCGGAAGGCAACCCCGCCTTTCCCAAGAAAAGCGTCGACATCTTCTTCCCAGAAACTGCACCCAACGA
CTTCCCCGTCGCCCTGCAAATCGCTCACAAGTACGGCGTCATCTTCATGGCGACCAAGTACGGCTTCATCCACGT
CTATGATCTCGAGACGGGAACGCCCATCTACATGAACCGAATCTCGAGCGAGACCATCTTCACCAGCTGCCTCGA
CGACGAGTCATCGGGCCTCGTCAGCATCAACCGCAAGGGTCAGGTTCTCTTCGTCTCCATCGACGACAACACCGT
CATCCCGTACCTCCTCGAGAACCCGGCCAACAGCCAGATCGCCATCAAGCTGGCTTCCAGAGCCGGCCTCGCGGG
TGCCGACAACCTCTACGCCACGCAGTTTGATCAGCTCTTCAAGTCCGGAAACTACATGGAAGCCGCCAAGGTGGC
GGCCAACTCGCCCCGTGGGTTCCTCCGCACCGCCGAGACGATAGAAAAGTTCAAGCGGCTGCCGCAGAATCCCGG
TCAGATGGCCTGGACCCTGCAGTACTTCGGCTTGCTCCTCGACAAGGGCACCCTGAACCGTCAGGAGACCATCGA
GCTCGCCAGCCCCGTGCTGCAGCAGAACCGGAAGCATCTGCTGGACAAGTGGTTCAAGGAGGGCAAGCTCGACTG
CTCGGAGCAGCTGGGCGACATGGTTCGACCGTACGACGTCAACATGGCCCTCACCATCTACCTCAAGGCCAACGT
GCCCCAAAAAGTCGTGGCCGGCCTCGCTGAGACGGGTCAGTTTGATAAGATCCTCCCCTACGCAGCCCAGACCGG
CTTCCAGCCCGACTACATCCAGCTCCTGCAGCACATCATCCGGACCAACCCGGAGAAGGGCAGCGAGTTCGCCAC
GGCGCTCGCGAACAGCGACCAGGGCCCGCTCGTCGACTTCGAGCGCGTCTGCGACATCTTCCAGTCGCAGGGCCT
GATACAGGAGGCTACGGCCTTTTTGCTAGAGGCCCTCAAGGAGAACAAGCCGGAGCACGCCCGTCTACAGACGCG
CCTCCTCGAGATGAACCTCATGCACGCGCCCCAGGTGGCCGACGCCATCCTCGGCAACGACATGTTCACCCACTT
TGACAAGCCGCGCATCGCCCAGCTGTGCGAGAACGCCGGCCTGATGCAAAAGGCCATGGAGCTGCACGAAGACCC
CGAGGCCATCAAGCGCGTCATCGTCAACATTGCCGGCAGCCCAAACTTCAACGCCGAGTGGCTCACCAACTACTT
TGGCAAGCTGTCGGTGGAGCAGTCGCTCGATTGCCTCGACGCCATGATGAAGCACAACATCCGCCAAAACTTGCA
GTCGGTCGTTAACATCGCCACCAAGTACTCGGAGCTTCTGGGGCCTGTCCGCCTCATCGACCTGTTTGAGAAGTA
CAAGACGGCCGAGGGTCTCTTCTACTACCTTGGCAGCATCGTCAACCTGACGGACGACCCGGACGTGCACTTCAA
GTACATCGAGGCCGCCACCGTGTCGCAGCAGTTCAACGAGGTGGAGCGCATCTGCCGGGACAGCAGCCACTACAA
CCCGGAAAAGGTCAAGAACTTCCTCAAGGAAGCCAAGCTGCCCGAGCAACTGCCGCTCATCATCGTGTGCGACCG
GTTCAACTTTGTGCACGACCTGATTCTGTACCTCTATCAGAATCAGCAGTTCCAGGCCATCGAGTCCTACGTCCA
GCGCGTCAATCCGTCGAGGACGCCGGCGGTCGTCGGCGGCCTCCTCGACGTCGACTGCGACGAGAGCATCATCAA
GCAGCTGCTGACGACGGTCAACGCCCAGCAGATCAATATTGACGAGCTGGTGTCCGAGGTGGAGTCGCGCAACCG
GCTCAAGCTGTTGCTGCCCTTCCTCGAGTCGGCGCTTCAGACGGGAGCCCAGCCGCAGGCGGTCTACAACGCGCT
GGCCAAGATTTACATCGACTCCAACAACAACCCGGAAAAGTTCCTCAAGGAGAACGACCAATACGACACGCTGAC
GATCGGAAAGTACTGCGAGAAGCGAGACCCCAATCTGGCCTTTATCGCCTACTCCAAGGGCCAGAACGACCTGGA
GCTCGTCAACATCACCAACGAGAACTCGATGTACCGGGCTCAGGCCCGTCACCTGCTTGAGCGGTCCGACAACGA
CCTCTGGCGCTTCGTCCTCAGCGAGAACAACATCCACCGACGCTCCGTCGTCGACCAGGTCATCGCCACGGCCGT
GCCCGAGTCGACGGACCCGGCCAAGGTGTCGGTCGCGGTCTCGGCCTTTCTCGAGAATGACTTGCCCCTGGAGCT
TATTGAGCTGCTGGAGAAGATTGTTCTCGAGCCCTCGCCGTTTAGCGACAACCAGAGCCTGCAGAACCTGTTGAT
GTTCACGGCGGCCAAGGCCGACAAGGCGCGCGTCATGGACTACATCCACAAGCTCGACGCCTACAACGCCGACGA
GATTGCCACGGCGTGCATCGAGGTCGGCCTGTTCGAGGAGGCCTTTGAGGTCTACAAAAAGGCCGACAACAAGAC
GGCGGCCGTCGACGTGCTGGTGGAGAACGTTGTCAGCATCGACCGGTCCCAGGCGTACGCCGAGGAGGTTGACCT
GCCCGAGGTCTGGAGTCGAGTGGCCAAGGCGCAGCTCGACGGCCTCCGCGTGCCAGACGCCATCGAGTCGTACAT
CAAGGCCGAGGACCCCAAGAACCACGAGGAGGTGATTGAGATTGCGACTTCGGCCGGCAAGAACGAGGAGCTCGT
CAAGTACCTTCGCATGGCGCGCAAGACGATGCGGGAGCCCGCCATCGACACGGCCCTGGCCTTTTGCTACGCCCG
CCTGGACCAGCTGCCGGACCTCGAGGACTTTTTGCGCGGCACAAACGTGGCCAACGTGGAAGAGTCGGGAGATAA
GGCGTACGAGGAGGGCTTCTTTGAGGCGTCCAAGATCTTCTACACGAGCATCTCCAACTGGGCCAAGCTGGCGAC
GACGCTGGTGCACCTGGACGACTACCAGGCGGCCGTCGACTGCGCGCGCAAGGCCAACAACATCAAGGTGTGGAA
GCAGGTGCACGAGGCGTGCGTGGAGAAGAGGGAGTTCAGGCTGGCGCAGATCTGCGGGCTGAACCTGATCGTGGA
CGCTGAGCAGCTGCAGACGCTGGTCAAGGAGTACGAGCGCAACGGCTACTTTGACGAGCTCATCAACCTGCTCGA
ACAGGGCCTCGGACTGGAGCGTGCGCACATGGGCATGTTTACCGAGCTGGGCATCGCGCTGTCCAAGTACCACCC
GGAGCGGCTGATGGAGCACATCAAGCTCTTCTGGTCCCGGATGAACATGCCCAAGATGATTCGGGCGTGCGAGGA
GGCCAACCTTTGGCCGGAGCTGGTGTTTTGCTACTGCCACTACGATGAGTTCGACAACGCGGCGCTGGCGGTCAT
TGAGAGGCCCGAGAACTCGTGGGAGCACCAGCAGTTCAAGGAGATTCTGGTCAAGGTGGCCAACCTCGAGATCTA
CTACCGCGGCATCCGGTTCTACGTGGAGCAGCACCCGTCGCTGCTGACGGATCTGTTGGCGGCGCTGACACCGCG
CATCGACGTCAACCGGGTGGTCAAGATGTTTCAGAAGAACGACAGCCTGCCGCTCATCAAGCCCTTCCTCCTCAA
CGTCCAGTCGCAAAACAAGCGCATCGTCAACGAGGCGGTCAACGACCTGCTGATCGAGGAGGAGGACTACAAGAC
GCTGCGCGACTCGGTGCACAACTACGACAACTACGACGCCGTGGGGCTGGCGAGCCGGCTGGAGAAGCACGACCT
CATCTTCTTCCGACAGATCGCGGCCAACATTTACCGCAAGAACAAGCGATGGGAGAAGTCGATTACGCTGTCGAA
GCAGGACAAGCTGTTCAAGGACGCCATCGAGACGGCGGCGACGTCAGGCAAGGCCGAGGTGGTGGAGGATCTGGT
CCGATATGTGAGTTTGTGTGGCGTGTCTGCTCTTGACGGCGCATCCGCTGACGGTCTCTTTCAGTTTGTCGATAT
TGGCCACCGAGAATGCTACACCGGCATGCTGTACGCGTGCAACGACCTCGTACGGCCGGACCTGGTGCTGGAGCT
GTCGTGGCGCAACGGCCTGATGGACTTTAGCATGCCTTATATGGTCAACATGCTGGCGCAGCAGACGAGGGAGAT
TGCGTTACTCAAGTCGGACAACGAGGCGCGCAAGTCCAAGGAAAAGGAGCAGGAGAAGACGGAGGACAACAAGCC
GATCCTGGGAGGGTCGCGGCTGATGATTACGGCCGGACCGACGGGGGGCAGCGTCATGGGGGGCGGAGGCGGCAT
GATGGGGGCGGAAGCGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail