Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06392
Gene name
Locationscaffold_07:2249045..2249703
Strand-
Gene length (bp)658
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01906 YbjQ_1 Putative heavy-metal-binding 7.6E-26 59 160

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5955 0.4035 0.0826 0.1376 0.4363 0.5207 0.1336 0.1174 0.1391 0.055

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6696
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06392 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6737
Ophiocordyceps kimflemingae Ophio5|4870
Ophiocordyceps subramaniannii Hirsu2|6140

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06392
MLLSAIVSGNREKSKRKRHSPPRTKMSSTAKPKAASEDVGGVPPTQLSELHCFTDTEGVITTTMMDLPGYRVVRV
LGTVYGISVRSRNVAASLGMALKSLIGGELSWFTTMLYSSRNDSVSRAVEECKRRGGNAIICLRFDAGAIDGFAQ
TAAYGTACIVEKVDDDVRPPQQQLEGVSDN*
Coding >Ophcf2|06392
ATGCTTCTCTCTGCCATCGTCAGCGGCAACCGGGAAAAGTCCAAGCGAAAACGCCACAGTCCTCCCCGAACCAAG
ATGTCGTCGACGGCCAAGCCGAAAGCGGCGTCCGAGGACGTTGGTGGTGTGCCGCCAACACAGCTATCGGAACTG
CACTGCTTCACTGACACCGAGGGTGTCATCACGACCACCATGATGGACCTGCCAGGATATCGCGTCGTGCGCGTC
CTCGGAACCGTGTACGGCATCAGCGTGCGATCGCGAAACGTGGCGGCCAGCTTGGGCATGGCGTTGAAGAGCCTG
ATCGGCGGCGAGTTGAGCTGGTTCACCACGATGCTGTACTCGAGCCGCAACGATTCGGTGAGCCGCGCGGTTGAG
GAGTGCAAGCGGCGCGGCGGCAATGCCATCATCTGTCTGCGTTTTGACGCCGGTGCCATAGACGGTTTCGCGCAG
ACGGCCGCCTACGGGACCGCTTGCATTGTGGAAAAGGTCGACGACGATGTCCGGCCGCCGCAGCAGCAGCTGGAG
GGCGTCAGCGACAACTAG
Transcript >Ophcf2|06392
ATGCTTCTCTCTGCCATCGTCAGCGGCAACCGGGAAAAGTCCAAGCGAAAACGCCACAGTCCTCCCCGAACCAAG
ATGTCGTCGACGGCCAAGCCGAAAGCGGCGTCCGAGGACGTTGGTGGTGTGCCGCCAACACAGCTATCGGAACTG
CACTGCTTCACTGACACCGAGGGTGTCATCACGACCACCATGATGGACCTGCCAGGATATCGCGTCGTGCGCGTC
CTCGGAACCGTGTACGGCATCAGCGTGCGATCGCGAAACGTGGCGGCCAGCTTGGGCATGGCGTTGAAGAGCCTG
ATCGGCGGCGAGTTGAGCTGGTTCACCACGATGCTGTACTCGAGCCGCAACGATTCGGTGAGCCGCGCGGTTGAG
GAGTGCAAGCGGCGCGGCGGCAATGCCATCATCTGTCTGCGTTTTGACGCCGGTGCCATAGACGGTTTCGCGCAG
ACGGCCGCCTACGGGACCGCTTGCATTGTGGAAAAGGTCGACGACGATGTCCGGCCGCCGCAGCAGCAGCTGGAG
GGCGTCAGCGACAACTAG
Gene >Ophcf2|06392
ATGCTTCTCTCTGCCATCGTCAGCGGCAACCGGGAAAAGTCCAAGGCAGGCTGTCCAGGCGAATGATTGACGGCA
AAGACTGACGCCAAAAACAGCGAAAACGCCACAGTCCTCCCCGAACCAAGATGTCGTCGACGGCCAAGCCGAAAG
CGGCGTCCGAGGACGTTGGTGGTGTGCCGCCAACACAGCTATCGGAACTGCACTGCTTCACTGACACCGAGGGTG
TCATCACGACCAGTGAGTATCCGGCGAACTCCCCGGAGCTATCGGCCCGCTCACACCGGCGGCGACACGATGCCT
AGCCATGATGGACCTGCCAGGATATCGCGTCGTGCGCGTCCTCGGAACCGTGTACGGCATCAGCGTGCGATCGCG
AAACGTGGCGGCCAGCTTGGGCATGGCGTTGAAGAGCCTGATCGGCGGCGAGTTGAGCTGGTTCACCACGATGCT
GTACTCGAGCCGCAACGATTCGGTGAGCCGCGCGGTTGAGGAGTGCAAGCGGCGCGGCGGCAATGCCATCATCTG
TCTGCGTTTTGACGCCGGTGCCATAGACGGTTTCGCGCAGACGGCCGCCTACGGGACCGCTTGCATTGTGGAAAA
GGTCGACGACGATGTCCGGCCGCCGCAGCAGCAGCTGGAGGGCGTCAGCGACAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail