Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06390
Gene name
Locationscaffold_07:2241078..2246111
Strand+
Gene length (bp)5033
Transcript length (bp)3945
Coding sequence length (bp)3945
Protein length (aa) 1315

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00562 RNA_pol_Rpb2_6 RNA polymerase Rpb2, domain 6 4.8E-113 760 1138
PF04563 RNA_pol_Rpb2_1 RNA polymerase beta subunit 1.4E-31 100 493
PF04565 RNA_pol_Rpb2_3 RNA polymerase Rpb2, domain 3 1.9E-28 549 613
PF06883 RNA_pol_Rpa2_4 RNA polymerase I, Rpa2 specific domain 7.0E-23 654 711
PF04561 RNA_pol_Rpb2_2 RNA polymerase Rpb2, domain 2 8.8E-22 261 459
PF04560 RNA_pol_Rpb2_7 RNA polymerase Rpb2, domain 7 1.0E-12 1141 1186

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0008152 metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0005488 binding No
GO:0016740 transferase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0046483 heterocycle metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0043227 membrane-bounded organelle No
GO:1901363 heterocyclic compound binding No
GO:0016779 nucleotidyltransferase activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043226 organelle No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0019438 aromatic compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0043229 intracellular organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0044238 primary metabolic process No
GO:0097747 RNA polymerase activity No
GO:0032774 RNA biosynthetic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.3256 0.7576 0.1718 0.0198 0.0787 0.0357 0.1549 0.067 0.0332 0.0028

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3322
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5662
Ophiocordyceps australis map64 (Brazil) OphauB2|6055
Ophiocordyceps camponoti-floridani Ophcf2|06390 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6936
Ophiocordyceps kimflemingae Ophio5|4868
Ophiocordyceps subramaniannii Hirsu2|6138

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06390
MDEPHRPSQERHGWRWTGQGFANGHGFVRGDFFLLSRPKCLGQAMTNRFRAEARPRSAGIMSSSPTETEWEHGFH
TLRRENLFRNPPTDHTAYPALQAAVDPHIRSFNRLFPSDGSLGLLALGLADIGSKTYFDGDRNVEPGARNKLTIR
YKTVTLQKPLLPAVNNLARNREILPSECRERNVTYRGKLTATFEYSINDDDPVEFSRELGQLPIMVKSNLCHLEN
NPPALLVRRKEESEELGGYFIINGIEKIVRLLQVNRRNFPMAIIRPTFANRGPGYTEFGVIIRSVRPDETSLTNV
LHYLKDGNVTLRFSWRKREYVIPIVMILKALIETNDREIYEGIVGTMNSKVQDSFIADRVELLLRTYSRHRIFGQ
RATRAWLGDKFRVVLGVPETMTNRDAGTEFLRKMVLVHLGNTDVTPSQDKDKFRLLLTMMRKLYALADGSCAVDN
PDAVQNQELLLGGFLYGQVLKERLEEFLTTKVSASLRDYLRKKPDVLFVSDDFHRDLPSKIFGKANESIGSGVEY
FLSTGNLQSTSGLDMQQRSGYTVVAEKLNFLRYISHFRSVHRGAFFSTLKTTTVRKLLPESWGFVCPVHTPDGTP
CGLLNHLAHRCDVTTDRLDVSALPKLAAELGVSKGPSSASTQESLVVMLDGRVLGWCSPAQCRRLADRIRQYKVE
GSHRVPLQLEIGLVPPSKGGTYPGLYMSSTAARMVRPVLHRALQAEDWVGPLEQPYMTIAVTEDEALDEETTHVE
LAPTNMLSILANMTPFSDFNQSPRNMYQCQMGKQTMGTPSTAMQSRADNKLYMLQTGQTPIVRPPLHNAYGFDNF
PNGTNAVVAVISYTGYDMDDAMIVNKSAHERGFSYGSVYKTHKISLKDGIRARAKKSVTKAFGFAPHGYVSAAQM
AMLDEDGLPPVGRLVRQGDVLCAYHTVSTDYSGRFVNTDGVTRFQRYREPEDCFVESVRILGADTGREPPQTVAI
KLRIPRAPVVGDKFSSRHGQKGICSQLWPAVDMPFSERGMQPDIIINPHAFPSRMTIGMFMESLAGKAGALHGQA
QDSTPFRYSDEEGETAADHFGKMLVDAGFNYHGNEAMYSGITGEELAADIFTGVVYYQRLRHMVSDKFQVRTTGR
VMPTTNQPVHGRQLGGGIRVGEMERDALIAHGCAFLLQDRLLNCSDYTPSWLCRSCGSFLSVQPAVPRYTPAPKP
TNTINTITTNTEAAAAAAAAAATTTAAATKAQQTQPPQTFRCRRCATPLDQTTAAPTGQDEVWEDGRGVAWVGGA
DTTQVVVPGALRFLDVELAAMGVRLRYNVGGGGLVRRGG*
Coding >Ophcf2|06390
ATGGACGAACCTCACCGGCCCAGCCAAGAGCGGCATGGCTGGAGATGGACGGGGCAGGGATTCGCCAACGGTCAC
GGCTTTGTACGAGGTGATTTTTTTCTGCTCAGCAGACCCAAGTGTCTAGGCCAGGCCATGACCAACCGCTTCCGC
GCAGAGGCACGACCTCGCTCAGCAGGCATCATGTCCTCTTCACCCACGGAGACGGAATGGGAACACGGGTTTCAC
ACTCTGCGTCGCGAAAATCTCTTTCGCAACCCTCCGACCGATCACACCGCCTACCCGGCTCTTCAAGCGGCCGTC
GACCCGCACATCCGCTCCTTCAACCGCCTGTTTCCCTCCGATGGCAGCCTGGGCTTGTTAGCGCTCGGTCTCGCG
GACATTGGCAGCAAGACGTACTTTGACGGAGATCGAAATGTCGAGCCGGGCGCGCGCAACAAGCTCACCATCCGG
TACAAGACCGTGACGCTGCAGAAGCCCTTGCTCCCTGCCGTCAACAACTTGGCTCGCAACAGAGAGATTCTGCCG
TCCGAGTGCAGGGAGCGGAACGTCACGTATAGGGGAAAGTTGACGGCTACCTTTGAGTATTCCATCAACGACGAC
GATCCGGTCGAGTTCTCGAGGGAACTGGGCCAGCTGCCCATCATGGTCAAGTCCAACCTATGCCATCTGGAAAAC
AACCCGCCGGCGCTGCTCGTACGGCGCAAGGAAGAGTCGGAGGAGCTGGGCGGTTACTTCATCATCAACGGCATC
GAAAAGATCGTTCGCTTGCTCCAGGTCAACAGGAGAAACTTTCCAATGGCGATAATACGGCCTACCTTTGCGAAC
CGTGGCCCGGGCTACACCGAGTTCGGAGTCATCATCCGCTCGGTCCGTCCAGACGAGACGTCGCTGACCAACGTG
CTGCACTACCTCAAGGACGGAAACGTCACGCTTCGCTTCTCGTGGCGCAAGCGCGAGTACGTGATACCGATCGTC
ATGATTCTCAAGGCCTTGATAGAGACAAACGATCGCGAGATCTACGAGGGCATCGTCGGGACCATGAATTCCAAG
GTCCAAGACAGCTTCATCGCCGACCGGGTCGAGTTGCTGCTGCGGACGTACAGCAGGCACCGCATCTTCGGCCAG
AGAGCGACGCGCGCCTGGTTGGGTGACAAGTTCCGCGTGGTTCTGGGCGTGCCCGAGACCATGACGAACCGCGAC
GCCGGCACCGAGTTCCTGCGCAAGATGGTGCTCGTCCATCTGGGCAACACGGACGTGACGCCGAGCCAGGACAAG
GACAAGTTCCGGCTGCTCCTCACCATGATGCGGAAGCTGTACGCGCTGGCTGACGGGAGCTGTGCCGTCGACAAC
CCGGACGCCGTGCAGAACCAGGAGCTCCTGTTGGGCGGCTTCCTGTACGGCCAGGTGCTCAAGGAGAGGCTGGAG
GAGTTTCTCACCACCAAGGTGTCGGCGTCGTTGCGGGATTACCTGCGCAAGAAGCCCGACGTGCTCTTCGTGTCG
GACGACTTCCACCGCGATCTCCCCAGCAAGATCTTCGGCAAGGCCAACGAGAGCATCGGCAGCGGCGTCGAGTAT
TTCTTGTCGACGGGAAACCTGCAGAGCACGTCTGGCCTGGACATGCAGCAGAGGTCGGGCTACACGGTGGTGGCG
GAGAAGCTCAACTTCCTACGATACATCAGCCACTTCCGGTCGGTGCATCGAGGTGCCTTCTTCTCGACGCTCAAG
ACGACGACGGTACGAAAGCTGCTCCCGGAATCGTGGGGGTTCGTGTGTCCCGTCCATACGCCGGATGGGACGCCG
TGCGGGCTGCTGAACCATCTGGCACACCGATGCGACGTGACGACGGATAGACTCGACGTCTCGGCCCTTCCCAAG
CTGGCGGCCGAGCTGGGCGTATCAAAGGGGCCCTCGTCGGCTTCGACTCAGGAGAGCCTGGTGGTGATGCTCGAC
GGCCGTGTGCTCGGCTGGTGTTCGCCCGCTCAGTGCCGACGGTTGGCAGACAGGATCCGACAGTACAAGGTCGAG
GGCTCTCACCGAGTGCCGCTTCAGCTCGAGATTGGCCTCGTGCCCCCGTCCAAGGGGGGAACATATCCGGGCCTC
TACATGAGCTCGACGGCGGCACGGATGGTCCGGCCGGTCCTCCATCGGGCGCTGCAGGCCGAGGACTGGGTCGGA
CCGCTGGAACAACCGTACATGACGATTGCGGTGACGGAGGACGAGGCCCTGGACGAAGAGACGACGCACGTCGAG
CTGGCTCCCACCAACATGCTGTCGATACTGGCCAACATGACGCCCTTTTCCGACTTTAACCAGTCTCCTCGCAAC
ATGTATCAGTGTCAGATGGGCAAGCAGACAATGGGCACACCCTCGACGGCCATGCAGTCCCGAGCCGACAACAAG
CTGTATATGCTTCAGACGGGTCAGACGCCCATCGTCCGTCCGCCTCTCCACAACGCGTACGGCTTCGACAACTTC
CCCAACGGGACAAACGCCGTCGTCGCCGTCATCTCGTACACGGGCTACGACATGGACGACGCCATGATCGTCAAC
AAGTCGGCTCACGAACGTGGCTTCAGCTACGGCTCCGTCTACAAGACGCACAAGATCTCTCTCAAGGACGGCATC
CGCGCCCGGGCCAAGAAGAGCGTCACCAAGGCCTTCGGCTTCGCGCCTCACGGCTACGTCAGCGCGGCGCAGATG
GCCATGCTCGATGAGGACGGCCTGCCCCCCGTCGGCCGACTCGTTCGCCAAGGCGACGTCCTGTGCGCTTACCAC
ACCGTCTCGACCGATTATAGCGGCCGCTTCGTCAACACGGACGGCGTCACGCGCTTTCAAAGATACCGCGAGCCG
GAAGACTGCTTCGTCGAATCGGTCCGCATCCTCGGCGCCGATACGGGAAGAGAACCCCCCCAGACAGTGGCCATC
AAGCTCCGCATCCCGCGCGCCCCCGTCGTAGGAGACAAGTTCTCCTCCCGTCACGGCCAAAAGGGCATCTGTTCC
CAGCTCTGGCCCGCCGTCGACATGCCCTTTTCCGAAAGAGGCATGCAGCCAGACATCATCATCAACCCGCACGCC
TTCCCCTCCCGCATGACCATCGGCATGTTCATGGAATCACTAGCCGGGAAAGCCGGCGCTCTTCACGGCCAGGCC
CAAGATTCCACCCCGTTTCGCTACTCGGACGAGGAGGGCGAGACGGCGGCGGATCACTTTGGGAAGATGCTCGTC
GACGCCGGTTTCAATTACCACGGAAACGAGGCCATGTACTCCGGCATCACGGGCGAGGAGCTGGCCGCCGACATC
TTTACGGGAGTCGTTTACTACCAGCGTCTCCGCCACATGGTCAGCGACAAGTTCCAGGTCCGGACGACGGGTCGC
GTCATGCCGACCACCAACCAGCCCGTTCACGGCCGTCAGCTCGGAGGCGGTATCCGAGTAGGCGAGATGGAACGC
GACGCCCTCATCGCCCACGGATGCGCCTTCTTACTCCAAGATCGTCTCCTCAACTGCTCGGATTACACCCCCTCC
TGGCTCTGCCGATCCTGCGGATCCTTCCTCTCCGTCCAACCCGCCGTCCCACGCTACACACCCGCTCCCAAACCC
ACCAACACCATCAACACCATCACCACCAACACAGAAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACAACAACA
GCAGCAGCAACCAAAGCCCAACAAACGCAACCCCCCCAAACATTCCGCTGCCGCCGCTGCGCAACCCCCCTCGAC
CAAACGACCGCCGCCCCGACGGGACAAGACGAGGTCTGGGAGGACGGCCGCGGCGTCGCCTGGGTCGGGGGCGCG
GATACCACCCAGGTCGTCGTCCCCGGCGCCTTGAGGTTCCTCGACGTCGAGCTTGCCGCCATGGGCGTGAGGCTG
AGGTATAATGTCGGCGGGGGCGGCTTGGTGAGGAGGGGGGGTTGA
Transcript >Ophcf2|06390
ATGGACGAACCTCACCGGCCCAGCCAAGAGCGGCATGGCTGGAGATGGACGGGGCAGGGATTCGCCAACGGTCAC
GGCTTTGTACGAGGTGATTTTTTTCTGCTCAGCAGACCCAAGTGTCTAGGCCAGGCCATGACCAACCGCTTCCGC
GCAGAGGCACGACCTCGCTCAGCAGGCATCATGTCCTCTTCACCCACGGAGACGGAATGGGAACACGGGTTTCAC
ACTCTGCGTCGCGAAAATCTCTTTCGCAACCCTCCGACCGATCACACCGCCTACCCGGCTCTTCAAGCGGCCGTC
GACCCGCACATCCGCTCCTTCAACCGCCTGTTTCCCTCCGATGGCAGCCTGGGCTTGTTAGCGCTCGGTCTCGCG
GACATTGGCAGCAAGACGTACTTTGACGGAGATCGAAATGTCGAGCCGGGCGCGCGCAACAAGCTCACCATCCGG
TACAAGACCGTGACGCTGCAGAAGCCCTTGCTCCCTGCCGTCAACAACTTGGCTCGCAACAGAGAGATTCTGCCG
TCCGAGTGCAGGGAGCGGAACGTCACGTATAGGGGAAAGTTGACGGCTACCTTTGAGTATTCCATCAACGACGAC
GATCCGGTCGAGTTCTCGAGGGAACTGGGCCAGCTGCCCATCATGGTCAAGTCCAACCTATGCCATCTGGAAAAC
AACCCGCCGGCGCTGCTCGTACGGCGCAAGGAAGAGTCGGAGGAGCTGGGCGGTTACTTCATCATCAACGGCATC
GAAAAGATCGTTCGCTTGCTCCAGGTCAACAGGAGAAACTTTCCAATGGCGATAATACGGCCTACCTTTGCGAAC
CGTGGCCCGGGCTACACCGAGTTCGGAGTCATCATCCGCTCGGTCCGTCCAGACGAGACGTCGCTGACCAACGTG
CTGCACTACCTCAAGGACGGAAACGTCACGCTTCGCTTCTCGTGGCGCAAGCGCGAGTACGTGATACCGATCGTC
ATGATTCTCAAGGCCTTGATAGAGACAAACGATCGCGAGATCTACGAGGGCATCGTCGGGACCATGAATTCCAAG
GTCCAAGACAGCTTCATCGCCGACCGGGTCGAGTTGCTGCTGCGGACGTACAGCAGGCACCGCATCTTCGGCCAG
AGAGCGACGCGCGCCTGGTTGGGTGACAAGTTCCGCGTGGTTCTGGGCGTGCCCGAGACCATGACGAACCGCGAC
GCCGGCACCGAGTTCCTGCGCAAGATGGTGCTCGTCCATCTGGGCAACACGGACGTGACGCCGAGCCAGGACAAG
GACAAGTTCCGGCTGCTCCTCACCATGATGCGGAAGCTGTACGCGCTGGCTGACGGGAGCTGTGCCGTCGACAAC
CCGGACGCCGTGCAGAACCAGGAGCTCCTGTTGGGCGGCTTCCTGTACGGCCAGGTGCTCAAGGAGAGGCTGGAG
GAGTTTCTCACCACCAAGGTGTCGGCGTCGTTGCGGGATTACCTGCGCAAGAAGCCCGACGTGCTCTTCGTGTCG
GACGACTTCCACCGCGATCTCCCCAGCAAGATCTTCGGCAAGGCCAACGAGAGCATCGGCAGCGGCGTCGAGTAT
TTCTTGTCGACGGGAAACCTGCAGAGCACGTCTGGCCTGGACATGCAGCAGAGGTCGGGCTACACGGTGGTGGCG
GAGAAGCTCAACTTCCTACGATACATCAGCCACTTCCGGTCGGTGCATCGAGGTGCCTTCTTCTCGACGCTCAAG
ACGACGACGGTACGAAAGCTGCTCCCGGAATCGTGGGGGTTCGTGTGTCCCGTCCATACGCCGGATGGGACGCCG
TGCGGGCTGCTGAACCATCTGGCACACCGATGCGACGTGACGACGGATAGACTCGACGTCTCGGCCCTTCCCAAG
CTGGCGGCCGAGCTGGGCGTATCAAAGGGGCCCTCGTCGGCTTCGACTCAGGAGAGCCTGGTGGTGATGCTCGAC
GGCCGTGTGCTCGGCTGGTGTTCGCCCGCTCAGTGCCGACGGTTGGCAGACAGGATCCGACAGTACAAGGTCGAG
GGCTCTCACCGAGTGCCGCTTCAGCTCGAGATTGGCCTCGTGCCCCCGTCCAAGGGGGGAACATATCCGGGCCTC
TACATGAGCTCGACGGCGGCACGGATGGTCCGGCCGGTCCTCCATCGGGCGCTGCAGGCCGAGGACTGGGTCGGA
CCGCTGGAACAACCGTACATGACGATTGCGGTGACGGAGGACGAGGCCCTGGACGAAGAGACGACGCACGTCGAG
CTGGCTCCCACCAACATGCTGTCGATACTGGCCAACATGACGCCCTTTTCCGACTTTAACCAGTCTCCTCGCAAC
ATGTATCAGTGTCAGATGGGCAAGCAGACAATGGGCACACCCTCGACGGCCATGCAGTCCCGAGCCGACAACAAG
CTGTATATGCTTCAGACGGGTCAGACGCCCATCGTCCGTCCGCCTCTCCACAACGCGTACGGCTTCGACAACTTC
CCCAACGGGACAAACGCCGTCGTCGCCGTCATCTCGTACACGGGCTACGACATGGACGACGCCATGATCGTCAAC
AAGTCGGCTCACGAACGTGGCTTCAGCTACGGCTCCGTCTACAAGACGCACAAGATCTCTCTCAAGGACGGCATC
CGCGCCCGGGCCAAGAAGAGCGTCACCAAGGCCTTCGGCTTCGCGCCTCACGGCTACGTCAGCGCGGCGCAGATG
GCCATGCTCGATGAGGACGGCCTGCCCCCCGTCGGCCGACTCGTTCGCCAAGGCGACGTCCTGTGCGCTTACCAC
ACCGTCTCGACCGATTATAGCGGCCGCTTCGTCAACACGGACGGCGTCACGCGCTTTCAAAGATACCGCGAGCCG
GAAGACTGCTTCGTCGAATCGGTCCGCATCCTCGGCGCCGATACGGGAAGAGAACCCCCCCAGACAGTGGCCATC
AAGCTCCGCATCCCGCGCGCCCCCGTCGTAGGAGACAAGTTCTCCTCCCGTCACGGCCAAAAGGGCATCTGTTCC
CAGCTCTGGCCCGCCGTCGACATGCCCTTTTCCGAAAGAGGCATGCAGCCAGACATCATCATCAACCCGCACGCC
TTCCCCTCCCGCATGACCATCGGCATGTTCATGGAATCACTAGCCGGGAAAGCCGGCGCTCTTCACGGCCAGGCC
CAAGATTCCACCCCGTTTCGCTACTCGGACGAGGAGGGCGAGACGGCGGCGGATCACTTTGGGAAGATGCTCGTC
GACGCCGGTTTCAATTACCACGGAAACGAGGCCATGTACTCCGGCATCACGGGCGAGGAGCTGGCCGCCGACATC
TTTACGGGAGTCGTTTACTACCAGCGTCTCCGCCACATGGTCAGCGACAAGTTCCAGGTCCGGACGACGGGTCGC
GTCATGCCGACCACCAACCAGCCCGTTCACGGCCGTCAGCTCGGAGGCGGTATCCGAGTAGGCGAGATGGAACGC
GACGCCCTCATCGCCCACGGATGCGCCTTCTTACTCCAAGATCGTCTCCTCAACTGCTCGGATTACACCCCCTCC
TGGCTCTGCCGATCCTGCGGATCCTTCCTCTCCGTCCAACCCGCCGTCCCACGCTACACACCCGCTCCCAAACCC
ACCAACACCATCAACACCATCACCACCAACACAGAAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACAACAACA
GCAGCAGCAACCAAAGCCCAACAAACGCAACCCCCCCAAACATTCCGCTGCCGCCGCTGCGCAACCCCCCTCGAC
CAAACGACCGCCGCCCCGACGGGACAAGACGAGGTCTGGGAGGACGGCCGCGGCGTCGCCTGGGTCGGGGGCGCG
GATACCACCCAGGTCGTCGTCCCCGGCGCCTTGAGGTTCCTCGACGTCGAGCTTGCCGCCATGGGCGTGAGGCTG
AGGTATAATGTCGGCGGGGGCGGCTTGGTGAGGAGGGGGGGTTGA
Gene >Ophcf2|06390
ATGGACGAACCTCACCGGCCCAGCCAAGAGCGGCATGGCTGGAGATGGACGGGGCAGGGATTCGCCAACGGTCAC
GGCTTTGTACGAGGTGATTTTTTTCTGCTCAGCAGACCCAAGTGTCTAGGCCAGGTAGGTACGGTAGCGTCCCAT
CCGTCTGCTCAACGGGGCGGTGATCAACAGTCTATTCCAAGGCCATGACGTGCAGACTCTTTTGCCTGTCTGTCG
GAGCAAACAAAGCGGAGAAGCCGAGTCTGAGTCTCACACCTTCAAACGCCTCCCCTCGAGCGCCCCTTCTCGAGC
GCCGACCCCTCAGACGCCTTGCCCGAGACGAGGCAAAGGCGGCCGGCCAACTCGGGCGGCGGCCGTTGGGCGTCC
ATGGGTATATGTAGATATCTACCTAGGTAGGTATCTGGATATTCCACTACCAGGATCCCGCTGGTCCTAAGCCTG
GGCGCCGTTGAAGCCATCTGGGACAGCACAGCAGAGGCGCGCTCCCCCCGGGTATCTTGCTGTCCGTCTCCGGGC
GTCCATGGCTCGAGCTCCTGGATACATACAGGTAGTAAGGTAAGTAGGTACCTACCTAGGTGGTCGGCGCGGGGT
AAAGATGCGCTATGTGTCCTGCTGACAACTACCTACCTAGGTAAGTACCTACCTATCTACCTACCTACCTAGGTA
TGTAGGTATCTGCCACATATTCGTATTCGTACATACGAGTACATACATAGGGACTTCGTACATGTTCGCGGCCTA
ACGCGCGGGCTTTGCATCGCATCGTCGTGCGTCTTGCAGGTCGTCATCGGACTGGCCTTGCAGCCTGCTTGTCTT
TGGCGCTGCTGCTAGCTGCTAGCTTTCGCCTGTCACTGGTCAGCTGTTTTTGCTTTGTGGGGTCGGATGACTAAG
GTGATGGTGAAAGAGAAGTTATCGATAGTCGATAGCCGCGTCTTGCTCTTATCGTGTTTTTTTTTTTTTTTTTTT
TTCCCAAAATCTGAGATTCTTGCGATGAGGCTCGTTCGTGATCTTCAAGACTGTCATTTCGTCGGCATTCGTTCC
AGCTACTTGATCACGACCATCTGCCGCAGATTCCCGAATCGAACTCTTCATCATATCGCAGAAATCCATTGATCC
CATCTTCATCTGGACGTGCAGCTGGGCGTGGCGCAATTCAGCAACCGCTTCCGCGCAGAGGCACGACCTCGCTCA
GCAGGCATCATGTCCTCTTCACCCACGGAGACGGAATGGGAACACGGGTTTCACACTCTGCGTCGCGAAAATCTC
TTTCGCAACCCTCCGACCGATCACACCGCCTACCCGGCTCTTCAAGCGGCCGTCGACCCGCACATCCGCTCCTTC
AACCGCCTGTTTCCCTCCGATGGCAGCCTGGGCTTGTTAGCGCTCGGTCTCGCGGACATTGGCAGCAAGACGTAC
TTTGACGGAGATCGAAATGTCGAGCCGGGCGCGCGCAACAAGCTCACCATCCGGTACAAGACCGTGACGCTGCAG
AAGCCCTTGCTCCCTGCCGTCAACAACTTGGCTCGCAACAGAGAGATTCTGCCGTCCGAGTGCAGGGAGCGGAAC
GTCACGTATAGGGGAAAGTTGACGGCTACCTTTGAGTATTCCATCAACGACGACGATCCGGTCGAGTTCTCGAGG
GAACTGGGCCAGCTGCCCATCATGGTCAAGGTGAGTGTCGCCATTCGTCTGTTTCGTTGGATTCCGAAGCTCACT
GTTGAAATGTTCAGTCCAACCTATGCCATCTGGAAAACAACCCGCCGGCGCTGCTCGTACGGCGCAAGGAAGAGT
CGGAGGAGCTGGGCGGTTACTTCATCATCAACGGCATCGAAAAGATCGTTCGCTTGCTCCAGGTCAACAGGAGAA
ACTTTCCAATGGCGATAATACGGCCTACCTTTGCGAACCGTGGCCCGGGCTACACCGAGTTCGGAGTCATCATCC
GCTCGGTCCGTCCAGACGAGACGTCGCTGACCAACGTGCTGCACTACCTCAAGGACGGAAACGTCACGCTTCGCT
TCTCGTGGCGCAAGCGCGAGTACGTGATACCGATCGTCATGATTCTCAAGGCCTTGATAGAGACAAACGATCGCG
AGATCTACGAGGGCATCGTCGGGACCATGAATTCCAAGGTCCAAGACAGCTTCATCGCCGACCGGGTCGAGTTGC
TGCTGCGGACGTACAGCAGGCACCGCATCTTCGGCCAGAGAGCGACGCGCGCCTGGTTGGGTGACAAGTTCCGCG
TGGTTCTGGGCGTGCCCGAGACCATGACGAACCGCGACGCCGGCACCGAGTTCCTGCGCAAGATGGTGCTCGTCC
ATCTGGGCAACACGGACGTGACGCCGAGCCAGGACAAGGACAAGTTCCGGCTGCTCCTCACCATGATGCGGAAGC
TGTACGCGCTGGCTGACGGGAGCTGTGCCGTCGACAACCCGGACGCCGTGCAGAACCAGGAGCTCCTGTTGGGCG
GCTTCCTGTACGGCCAGGTGCTCAAGGAGAGGCTGGAGGAGTTTCTCACCACCAAGGTGTCGGCGTCGTTGCGGG
ATTACCTGCGCAAGAAGCCCGACGTGCTCTTCGTGTCGGACGACTTCCACCGCGATCTCCCCAGCAAGATCTTCG
GCAAGGCCAACGAGAGCATCGGCAGCGGCGTCGAGTATTTCTTGTCGACGGGAAACCTGCAGAGCACGTCTGGCC
TGGACATGCAGCAGAGGTCGGGCTACACGGTGGTGGCGGAGAAGCTCAACTTCCTACGATACATCAGCCACTTCC
GGTCGGTGCATCGAGGTGCCTTCTTCTCGACGCTCAAGACGACGACGGTACGAAAGCTGCTCCCGGAATCGTGGG
GGTTCGTGTGTCCCGTCCATACGCCGGATGGGACGCCGTGCGGGCTGCTGAACCATCTGGCACACCGATGCGACG
TGACGACGGATAGACTCGACGTCTCGGCCCTTCCCAAGCTGGCGGCCGAGCTGGGCGTATCAAAGGGGCCCTCGT
CGGCTTCGACTCAGGAGAGCCTGGTGGTGATGCTCGACGGCCGTGTGCTCGGCTGGTGTTCGCCCGCTCAGTGCC
GACGGTTGGCAGACAGGATCCGACAGTACAAGGTCGAGGGCTCTCACCGAGTGCCGCTTCAGCTCGAGATTGGCC
TCGTGCCCCCGTCCAAGGGGGGAACATATCCGGGCCTCTACATGAGCTCGACGGCGGCACGGATGGTCCGGCCGG
TCCTCCATCGGGCGCTGCAGGCCGAGGACTGGGTCGGACCGCTGGAACAACCGTACATGACGATTGCGGTGACGG
AGGACGAGGCCCTGGACGAAGAGACGACGCACGTCGAGCTGGCTCCCACCAACATGCTGTCGATACTGGCCAACA
TGACGCCCTTTTCCGACTTTAACCAGTCTCCTCGCAACATGTATCAGTGTCAGATGGGCAAGCAGACAATGGGCA
CACCCTCGACGGCCATGCAGTCCCGAGCCGACAACAAGCTGTATATGCTTCAGACGGGTCAGACGCCCATCGTCC
GTCCGCCTCTCCACAACGCGTACGGCTTCGACAACTTCCCCAACGGGACAAACGCCGTCGTCGCCGTCATCTCGT
ACACGGGCTACGACATGGACGACGCCATGATCGTCAACAAGTCGGCTCACGAACGTGGCTTCAGCTACGGCTCCG
TCTACAAGACGCACAAGATCTCTCTCAAGGACGGCATCCGCGCCCGGGCCAAGAAGAGCGTCACCAAGGCCTTCG
GCTTCGCGCCTCACGGCTACGTCAGCGCGGCGCAGATGGCCATGCTCGATGAGGACGGCCTGCCCCCCGTCGGCC
GACTCGTTCGCCAAGGCGACGTCCTGTGCGCTTACCACACCGTCTCGACCGATTATAGCGGCCGCTTCGTCAACA
CGGACGGCGTCACGCGCTTTCAAAGATACCGCGAGCCGGAAGACTGCTTCGTCGAATCGGTCCGCATCCTCGGCG
CCGATACGGGAAGAGAACCCCCCCAGACAGTGGCCATCAAGCTCCGCATCCCGCGCGCCCCCGTCGTAGGAGACA
AGTTCTCCTCCCGTCACGGCCAAAAGGGCATCTGTTCCCAGCTCTGGCCCGCCGTCGACATGCCCTTTTCCGAAA
GAGGCATGCAGCCAGACATCATCATCAACCCGCACGCCTTCCCCTCCCGCATGACCATCGGCATGTTCATGGAAT
CACTAGCCGGGAAAGCCGGCGCTCTTCACGGCCAGGCCCAAGATTCCACCCCGTTTCGCTACTCGGACGAGGAGG
GCGAGACGGCGGCGGATCACTTTGGGAAGATGCTCGTCGACGCCGGTTTCAATTACCACGGAAACGAGGCCATGT
ACTCCGGCATCACGGGCGAGGAGCTGGCCGCCGACATCTTTACGGGAGTCGTTTACTACCAGCGTCTCCGCCACA
TGGTCAGCGACAAGTTCCAGGTCCGGACGACGGGTCGCGTCATGCCGACCACCAACCAGCCCGTTCACGGCCGTC
AGCTCGGAGGCGGTATCCGAGTAGGCGAGATGGAACGCGACGCCCTCATCGCCCACGGATGCGCCTTCTTACTCC
AAGATCGTCTCCTCAACTGCTCGGATTACACCCCCTCCTGGCTCTGCCGATCCTGCGGATCCTTCCTCTCCGTCC
AACCCGCCGTCCCACGCTACACACCCGCTCCCAAACCCACCAACACCATCAACACCATCACCACCAACACAGAAG
CAGCAGCAGCAGCAGCAGCAGCAGCAGCAACAACAACAGCAGCAGCAACCAAAGCCCAACAAACGCAACCCCCCC
AAACATTCCGCTGCCGCCGCTGCGCAACCCCCCTCGACCAAACGACCGCCGCCCCGACGGGACAAGACGAGGTCT
GGGAGGACGGCCGCGGCGTCGCCTGGGTCGGGGGCGCGGATACCACCCAGGTCGTCGTCCCCGGCGCCTTGAGGT
TCCTCGACGTCGAGCTTGCCGCCATGGGCGTGAGGCTGAGGTATAATGTCGGCGGGGGCGGCTTGGTGAGGAGGG
GGGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail