Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06388
Gene name
Locationscaffold_07:2236706..2237961
Strand-
Gene length (bp)1255
Transcript length (bp)1116
Coding sequence length (bp)1116
Protein length (aa) 372

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01212 Beta_elim_lyase Beta-eliminating lyase 3.7E-67 26 312

GO

GO Term Description Terminal node
GO:0016829 lyase activity Yes
GO:0006520 cellular amino acid metabolic process Yes
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7448 0.2823 0.0495 0.0888 0.3643 0.5525 0.0855 0.2919 0.145 0.0434

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1374
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|169
Ophiocordyceps australis map64 (Brazil) OphauB2|6059
Ophiocordyceps camponoti-floridani Ophcf2|06388 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7609
Ophiocordyceps kimflemingae Ophio5|7875
Ophiocordyceps subramaniannii Hirsu2|10807

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06388
MGCGTGIGDEEVPSTWIGVDGPGSVDLRSDVVTTPTPSMLAAVRSCSLLDDVFCEDPTTAQLEAHVAALTGKDAG
LFVLSGTMGNQLALRSLLVQPPHGVLCDQRSHIVQHEAGGVSSLTGASVVSVVPENGKHLTLSDVSAHVALGDDV
HSCPTRVISLENTLHGLVMPLSETRLIADLARRNGIKMHLDGARLWEAVAAGAGSLTDFCSLFDTVSLCFSKGLG
APAGSVLVGSGETIKHARWVRKSLGGGLRQSGVVAAAARVAVDETFGKTGDGADGLLGASHDMAKRVEALWTARG
GSLVYPVHTNMCWLDLDGAGCSPERFIEMGADEGLKLSGGRLVTHYQIAQRADDVVARLGRVFDRVFAEAG*
Coding >Ophcf2|06388
ATGGGCTGTGGCACCGGGATTGGAGACGAGGAGGTGCCCTCGACTTGGATTGGCGTCGACGGGCCGGGCTCCGTG
GACCTGAGGAGCGACGTGGTGACGACGCCGACGCCATCCATGTTAGCCGCCGTCCGGTCTTGCTCGTTGCTCGAC
GACGTCTTCTGCGAGGACCCGACGACGGCTCAGCTCGAGGCTCACGTGGCTGCCTTGACCGGCAAAGACGCCGGC
TTGTTTGTCCTGTCCGGCACCATGGGCAACCAGCTCGCGTTGAGGAGCCTCCTCGTCCAACCTCCTCACGGCGTC
CTGTGTGACCAGCGGTCGCACATAGTGCAGCACGAGGCAGGCGGGGTATCGTCCCTGACCGGGGCCTCGGTCGTG
TCCGTCGTGCCCGAAAATGGCAAGCATCTGACGCTTTCCGACGTCTCGGCTCACGTCGCTCTCGGTGACGATGTC
CACAGCTGCCCGACGAGGGTCATCAGCCTGGAGAACACGCTGCACGGTCTCGTGATGCCGCTGAGCGAGACGCGG
CTCATCGCAGACCTGGCGAGGCGGAACGGTATCAAGATGCATCTGGACGGGGCGCGTCTCTGGGAAGCCGTCGCA
GCGGGAGCAGGGAGCCTGACGGACTTTTGCTCCCTCTTCGACACCGTCAGCCTCTGCTTCTCCAAGGGCCTGGGT
GCACCGGCGGGCAGCGTGCTGGTTGGTTCGGGCGAGACCATCAAGCACGCGCGGTGGGTGCGCAAGTCGCTGGGC
GGCGGTCTTCGCCAGTCAGGCGTCGTGGCGGCAGCGGCCAGGGTGGCTGTAGACGAGACGTTTGGAAAGACGGGA
GACGGGGCCGACGGTCTGCTGGGGGCCTCGCACGACATGGCCAAGAGGGTCGAGGCTCTGTGGACGGCCAGGGGG
GGCTCGCTGGTGTATCCTGTGCACACCAACATGTGCTGGCTGGATCTGGACGGCGCCGGCTGCAGCCCTGAGCGT
TTCATCGAGATGGGGGCCGATGAGGGCCTGAAGCTGTCGGGAGGACGGCTGGTGACGCACTACCAGATCGCGCAA
CGGGCCGACGACGTCGTTGCACGGCTGGGGCGCGTCTTTGATCGTGTCTTTGCCGAGGCCGGCTGA
Transcript >Ophcf2|06388
ATGGGCTGTGGCACCGGGATTGGAGACGAGGAGGTGCCCTCGACTTGGATTGGCGTCGACGGGCCGGGCTCCGTG
GACCTGAGGAGCGACGTGGTGACGACGCCGACGCCATCCATGTTAGCCGCCGTCCGGTCTTGCTCGTTGCTCGAC
GACGTCTTCTGCGAGGACCCGACGACGGCTCAGCTCGAGGCTCACGTGGCTGCCTTGACCGGCAAAGACGCCGGC
TTGTTTGTCCTGTCCGGCACCATGGGCAACCAGCTCGCGTTGAGGAGCCTCCTCGTCCAACCTCCTCACGGCGTC
CTGTGTGACCAGCGGTCGCACATAGTGCAGCACGAGGCAGGCGGGGTATCGTCCCTGACCGGGGCCTCGGTCGTG
TCCGTCGTGCCCGAAAATGGCAAGCATCTGACGCTTTCCGACGTCTCGGCTCACGTCGCTCTCGGTGACGATGTC
CACAGCTGCCCGACGAGGGTCATCAGCCTGGAGAACACGCTGCACGGTCTCGTGATGCCGCTGAGCGAGACGCGG
CTCATCGCAGACCTGGCGAGGCGGAACGGTATCAAGATGCATCTGGACGGGGCGCGTCTCTGGGAAGCCGTCGCA
GCGGGAGCAGGGAGCCTGACGGACTTTTGCTCCCTCTTCGACACCGTCAGCCTCTGCTTCTCCAAGGGCCTGGGT
GCACCGGCGGGCAGCGTGCTGGTTGGTTCGGGCGAGACCATCAAGCACGCGCGGTGGGTGCGCAAGTCGCTGGGC
GGCGGTCTTCGCCAGTCAGGCGTCGTGGCGGCAGCGGCCAGGGTGGCTGTAGACGAGACGTTTGGAAAGACGGGA
GACGGGGCCGACGGTCTGCTGGGGGCCTCGCACGACATGGCCAAGAGGGTCGAGGCTCTGTGGACGGCCAGGGGG
GGCTCGCTGGTGTATCCTGTGCACACCAACATGTGCTGGCTGGATCTGGACGGCGCCGGCTGCAGCCCTGAGCGT
TTCATCGAGATGGGGGCCGATGAGGGCCTGAAGCTGTCGGGAGGACGGCTGGTGACGCACTACCAGATCGCGCAA
CGGGCCGACGACGTCGTTGCACGGCTGGGGCGCGTCTTTGATCGTGTCTTTGCCGAGGCCGGCTGA
Gene >Ophcf2|06388
ATGGGCTGTGGCACCGGGATTGGAGACGAGGAGGTGCCCTCGACTTGGATTGGCGTCGACGGGCCGGGCTCCGTG
GACCTGAGGAGTGAGATGATGGCCTTCTCATCGTCTAAAACTCCATGACGCTGAGCCCCTTTCACAGGCGACGTG
GTGACGACGCCGACGCCATCCATGTTAGCCGCCGTCCGGTCTTGCTCGTTGCTCGACGACGTCTTCTGCGAGGAC
CCGACGACGGCTCAGCTCGAGGCTCACGTGGCTGCCTTGACCGGCAAAGACGCCGGCTTGTTTGTCCTGTCCGGC
ACCATGGGCAACCAGCTCGCGTTGAGGAGCCTCCTCGTCCAACCTCCTCACGGCGTCCTGTGTGACCAGCGGTCG
CACATAGTGCAGCACGAGGCAGGCGGGTACGTGGCCCCCTTCCCCTATTTCCCATCTTCCGTGTCCCGGCGTCGC
CGTCGTCGTCGCCTTCTGACGCGGCCTGCGCAGGGTATCGTCCCTGACCGGGGCCTCGGTCGTGTCCGTCGTGCC
CGAAAATGGCAAGCATCTGACGCTTTCCGACGTCTCGGCTCACGTCGCTCTCGGTGACGATGTCCACAGCTGCCC
GACGAGGGTCATCAGCCTGGAGAACACGCTGCACGGTCTCGTGATGCCGCTGAGCGAGACGCGGCTCATCGCAGA
CCTGGCGAGGCGGAACGGTATCAAGATGCATCTGGACGGGGCGCGTCTCTGGGAAGCCGTCGCAGCGGGAGCAGG
GAGCCTGACGGACTTTTGCTCCCTCTTCGACACCGTCAGCCTCTGCTTCTCCAAGGGCCTGGGTGCACCGGCGGG
CAGCGTGCTGGTTGGTTCGGGCGAGACCATCAAGCACGCGCGGTGGGTGCGCAAGTCGCTGGGCGGCGGTCTTCG
CCAGTCAGGCGTCGTGGCGGCAGCGGCCAGGGTGGCTGTAGACGAGACGTTTGGAAAGACGGGAGACGGGGCCGA
CGGTCTGCTGGGGGCCTCGCACGACATGGCCAAGAGGGTCGAGGCTCTGTGGACGGCCAGGGGGGGCTCGCTGGT
GTATCCTGTGCACACCAACATGTGCTGGCTGGATCTGGACGGCGCCGGCTGCAGCCCTGAGCGTTTCATCGAGAT
GGGGGCCGATGAGGGCCTGAAGCTGTCGGGAGGACGGCTGGTGACGCACTACCAGATCGCGCAACGGGCCGACGA
CGTCGTTGCACGGCTGGGGCGCGTCTTTGATCGTGTCTTTGCCGAGGCCGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail