Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06387
Gene name
Locationscaffold_07:2233994..2235902
Strand-
Gene length (bp)1908
Transcript length (bp)1746
Coding sequence length (bp)1746
Protein length (aa) 582

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00264 Tyrosinase Common central domain of tyrosinase 4.1E-47 90 346
PF18132 Tyosinase_C Tyosinase C-terminal domain 1.2E-22 445 556

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06387
MLRTLYALVLVSNSLAVAGLAGYDFGIDVAHLHRRHDVATPIVVERLPLAFDGSIPLRLEIRQLSMDQHRWDLYI
LALSMMQTADQADPLSWYQIAGIHGVPFQPWNGVLPAAGAAESGYCTHNSVLFPLWHRPYMALFEQQMFRLVNAI
ASMFANVAERQLYQRAAADFRVPYWDWSRSAPAGETHLPIVFWNPVVMQNGPNGVQTISNPLYSYQFHPLDSEAF
IWNPLKQWNETKRGPETAISLTAPPSNNEKVNAALLSKLPEIQQRLYVLFSNYHDFNSFSNKAWAVSQGLSALDS
IESVHDMIHLYGGSKGHLTYVPLSSFDPLFFLHHGMTDRLIAMWQVLNPSAWITPMAAGETTFTAVKGTMQTADS
PLTPFYSSTNGTFWTSNSARTTEAFGYAYADTSPGDVRLALIGKINDWYGPSRGNEANVLVSSSSGRYTEWLANV
HVEAGSVQGPLTVHLFLGEAPSDKSAWETAANRAGSVGVLAAMGQTTAKISGAVPLTSALRRSKAPDQLGPAAVT
PWLRGRLQFRILGVDDQELDPRHVGGLYVAISSAEVEVTDELPRWGPATTRLELWP*
Coding >Ophcf2|06387
ATGCTTCGAACTTTGTACGCCCTGGTCCTGGTCTCAAACTCCCTGGCTGTCGCCGGCCTCGCGGGTTACGACTTT
GGCATCGACGTCGCTCATCTTCATCGTCGCCACGATGTCGCTACTCCCATCGTCGTCGAGAGATTACCGCTGGCG
TTTGATGGCAGCATTCCCCTGAGACTCGAGATCCGCCAGTTGAGCATGGACCAGCACAGATGGGATCTGTATATA
CTGGCCCTCAGCATGATGCAGACGGCCGACCAAGCCGATCCCCTTTCGTGGTACCAGATCGCTGGCATTCACGGT
GTCCCCTTTCAGCCCTGGAACGGGGTCCTGCCCGCAGCGGGAGCCGCCGAGTCGGGCTATTGCACCCACAACTCG
GTCCTGTTTCCCCTCTGGCACAGGCCTTACATGGCCCTATTCGAGCAACAAATGTTCCGGCTGGTCAACGCCATC
GCCTCCATGTTTGCAAACGTAGCCGAGAGGCAGCTCTATCAGCGCGCGGCGGCAGACTTCAGGGTGCCCTATTGG
GACTGGTCCAGAAGCGCTCCCGCCGGCGAGACGCATTTACCGATCGTATTTTGGAACCCCGTGGTGATGCAGAAC
GGCCCCAACGGAGTGCAGACCATCAGTAACCCCCTATATTCGTACCAATTTCACCCCCTCGACAGCGAGGCCTTC
ATTTGGAACCCGCTGAAGCAATGGAACGAGACCAAGAGAGGGCCGGAGACGGCCATCAGTCTCACGGCTCCGCCT
TCCAACAACGAAAAGGTGAACGCGGCGCTGCTGTCGAAGCTGCCCGAGATCCAGCAGCGGTTGTACGTGCTCTTC
TCCAACTACCACGACTTCAATTCGTTCAGCAACAAGGCCTGGGCTGTGTCGCAGGGCCTCTCGGCGCTCGACTCG
ATCGAGTCGGTACACGACATGATTCACCTGTACGGAGGCTCCAAGGGGCACCTGACGTATGTCCCGCTGTCTTCG
TTTGACCCTCTTTTCTTCCTGCACCACGGCATGACGGACCGCCTCATCGCCATGTGGCAGGTGCTCAATCCGTCG
GCGTGGATCACGCCCATGGCGGCGGGTGAGACAACCTTTACAGCGGTCAAGGGCACGATGCAGACGGCAGACAGC
CCGCTGACGCCCTTTTACTCGTCGACCAACGGGACCTTTTGGACGTCCAACTCGGCCAGGACGACGGAGGCCTTT
GGATACGCCTACGCGGACACGAGCCCGGGCGACGTGCGGCTGGCTCTGATTGGCAAGATCAACGATTGGTACGGC
CCGTCTAGGGGAAATGAGGCCAATGTCTTGGTGTCGTCGTCGAGCGGGCGGTACACGGAGTGGCTGGCCAACGTA
CACGTCGAAGCGGGCTCGGTGCAGGGCCCGTTGACGGTACACCTGTTCCTGGGCGAGGCACCGAGCGACAAGAGC
GCGTGGGAGACGGCGGCGAACCGGGCCGGGTCGGTAGGCGTCTTGGCCGCCATGGGCCAGACGACGGCTAAGATT
TCAGGCGCGGTGCCGCTGACCTCGGCCCTGAGGAGGAGCAAGGCACCGGATCAGCTGGGCCCCGCCGCGGTGACG
CCCTGGCTCAGGGGGCGTCTGCAGTTCCGAATACTTGGCGTCGACGACCAGGAGCTGGACCCAAGGCATGTCGGG
GGGCTGTACGTGGCCATCAGCAGCGCCGAGGTGGAGGTGACGGACGAGCTTCCGCGCTGGGGGCCGGCGACGACG
CGACTGGAGCTGTGGCCGTGA
Transcript >Ophcf2|06387
ATGCTTCGAACTTTGTACGCCCTGGTCCTGGTCTCAAACTCCCTGGCTGTCGCCGGCCTCGCGGGTTACGACTTT
GGCATCGACGTCGCTCATCTTCATCGTCGCCACGATGTCGCTACTCCCATCGTCGTCGAGAGATTACCGCTGGCG
TTTGATGGCAGCATTCCCCTGAGACTCGAGATCCGCCAGTTGAGCATGGACCAGCACAGATGGGATCTGTATATA
CTGGCCCTCAGCATGATGCAGACGGCCGACCAAGCCGATCCCCTTTCGTGGTACCAGATCGCTGGCATTCACGGT
GTCCCCTTTCAGCCCTGGAACGGGGTCCTGCCCGCAGCGGGAGCCGCCGAGTCGGGCTATTGCACCCACAACTCG
GTCCTGTTTCCCCTCTGGCACAGGCCTTACATGGCCCTATTCGAGCAACAAATGTTCCGGCTGGTCAACGCCATC
GCCTCCATGTTTGCAAACGTAGCCGAGAGGCAGCTCTATCAGCGCGCGGCGGCAGACTTCAGGGTGCCCTATTGG
GACTGGTCCAGAAGCGCTCCCGCCGGCGAGACGCATTTACCGATCGTATTTTGGAACCCCGTGGTGATGCAGAAC
GGCCCCAACGGAGTGCAGACCATCAGTAACCCCCTATATTCGTACCAATTTCACCCCCTCGACAGCGAGGCCTTC
ATTTGGAACCCGCTGAAGCAATGGAACGAGACCAAGAGAGGGCCGGAGACGGCCATCAGTCTCACGGCTCCGCCT
TCCAACAACGAAAAGGTGAACGCGGCGCTGCTGTCGAAGCTGCCCGAGATCCAGCAGCGGTTGTACGTGCTCTTC
TCCAACTACCACGACTTCAATTCGTTCAGCAACAAGGCCTGGGCTGTGTCGCAGGGCCTCTCGGCGCTCGACTCG
ATCGAGTCGGTACACGACATGATTCACCTGTACGGAGGCTCCAAGGGGCACCTGACGTATGTCCCGCTGTCTTCG
TTTGACCCTCTTTTCTTCCTGCACCACGGCATGACGGACCGCCTCATCGCCATGTGGCAGGTGCTCAATCCGTCG
GCGTGGATCACGCCCATGGCGGCGGGTGAGACAACCTTTACAGCGGTCAAGGGCACGATGCAGACGGCAGACAGC
CCGCTGACGCCCTTTTACTCGTCGACCAACGGGACCTTTTGGACGTCCAACTCGGCCAGGACGACGGAGGCCTTT
GGATACGCCTACGCGGACACGAGCCCGGGCGACGTGCGGCTGGCTCTGATTGGCAAGATCAACGATTGGTACGGC
CCGTCTAGGGGAAATGAGGCCAATGTCTTGGTGTCGTCGTCGAGCGGGCGGTACACGGAGTGGCTGGCCAACGTA
CACGTCGAAGCGGGCTCGGTGCAGGGCCCGTTGACGGTACACCTGTTCCTGGGCGAGGCACCGAGCGACAAGAGC
GCGTGGGAGACGGCGGCGAACCGGGCCGGGTCGGTAGGCGTCTTGGCCGCCATGGGCCAGACGACGGCTAAGATT
TCAGGCGCGGTGCCGCTGACCTCGGCCCTGAGGAGGAGCAAGGCACCGGATCAGCTGGGCCCCGCCGCGGTGACG
CCCTGGCTCAGGGGGCGTCTGCAGTTCCGAATACTTGGCGTCGACGACCAGGAGCTGGACCCAAGGCATGTCGGG
GGGCTGTACGTGGCCATCAGCAGCGCCGAGGTGGAGGTGACGGACGAGCTTCCGCGCTGGGGGCCGGCGACGACG
CGACTGGAGCTGTGGCCGTGA
Gene >Ophcf2|06387
ATGCTTCGAACTTTGTACGCCCTGGTCCTGGTCTCAAACTCCCTGGCTGTCGCCGGCCTCGCGGGTTACGACTTT
GGCATCGACGTCGCTCATCTTCATCGTCGCCACGATGTCGCTACTCCCATCGTCGTCGAGAGATTACCGCTGGCG
TTTGATGGCAGCATTCCCCTGAGACTCGAGATCCGCCAGTTGAGCATGGACCAGCACAGATGGGATCTGTATATA
CTGGCCCTCAGCATGATGCAGACGGCCGACCAAGCCGATCCCCTTTCGTGGTACCAGATCGCTGGTGGGTTGGCA
GTCGCTTGTGTTCACGGGGTACGACGGCTGATTTGCGTCGACCAGGCATTCACGGTGTCCCCTTTCAGCCCTGGA
ACGGGGTCCTGCCCGCAGCGGGAGCCGCCGAGTCGGGCTATTGCACCCACAACTCGGTCCTGTTTCCCCTCTGGC
ACAGGCCTTACATGGCCCTATTCGAGGTGAGCTGTCACGGCTTGCCTGAGACGCTTTCGTCAACTGAAAGAAGGA
TGGAAGCAACAAATGTTCCGGCTGGTCAACGCCATCGCCTCCATGTTTGCAAACGTAGCCGAGAGGCAGCTCTAT
CAGCGCGCGGCGGCAGACTTCAGGGTGCCCTATTGGGACTGGTCCAGAAGCGCTCCCGCCGGCGAGACGCATTTA
CCGATCGTATTTTGGAACCCCGTGGTGATGCAGAACGGCCCCAACGGAGTGCAGACCATCAGTAACCCCCTATAT
TCGTACCAATTTCACCCCCTCGACAGCGAGGCCTTCATTTGGAACCCGGTAAGCTACCCGGCTGCCTCGTGCCGG
CGCGCCGCTGACGTCGACGCAAAGCTGAAGCAATGGAACGAGACCAAGAGAGGGCCGGAGACGGCCATCAGTCTC
ACGGCTCCGCCTTCCAACAACGAAAAGGTGAACGCGGCGCTGCTGTCGAAGCTGCCCGAGATCCAGCAGCGGTTG
TACGTGCTCTTCTCCAACTACCACGACTTCAATTCGTTCAGCAACAAGGCCTGGGCTGTGTCGCAGGGCCTCTCG
GCGCTCGACTCGATCGAGTCGGTACACGACATGATTCACCTGTACGGAGGCTCCAAGGGGCACCTGACGTATGTC
CCGCTGTCTTCGTTTGACCCTCTTTTCTTCCTGCACCACGGCATGACGGACCGCCTCATCGCCATGTGGCAGGTG
CTCAATCCGTCGGCGTGGATCACGCCCATGGCGGCGGGTGAGACAACCTTTACAGCGGTCAAGGGCACGATGCAG
ACGGCAGACAGCCCGCTGACGCCCTTTTACTCGTCGACCAACGGGACCTTTTGGACGTCCAACTCGGCCAGGACG
ACGGAGGCCTTTGGATACGCCTACGCGGACACGAGCCCGGGCGACGTGCGGCTGGCTCTGATTGGCAAGATCAAC
GATTGGTACGGCCCGTCTAGGGGAAATGAGGCCAATGTCTTGGTGTCGTCGTCGAGCGGGCGGTACACGGAGTGG
CTGGCCAACGTACACGTCGAAGCGGGCTCGGTGCAGGGCCCGTTGACGGTACACCTGTTCCTGGGCGAGGCACCG
AGCGACAAGAGCGCGTGGGAGACGGCGGCGAACCGGGCCGGGTCGGTAGGCGTCTTGGCCGCCATGGGCCAGACG
ACGGCTAAGATTTCAGGCGCGGTGCCGCTGACCTCGGCCCTGAGGAGGAGCAAGGCACCGGATCAGCTGGGCCCC
GCCGCGGTGACGCCCTGGCTCAGGGGGCGTCTGCAGTTCCGAATACTTGGCGTCGACGACCAGGAGCTGGACCCA
AGGCATGTCGGGGGGCTGTACGTGGCCATCAGCAGCGCCGAGGTGGAGGTGACGGACGAGCTTCCGCGCTGGGGG
CCGGCGACGACGCGACTGGAGCTGTGGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail