Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06383
Gene name
Locationscaffold_07:2224326..2225003
Strand+
Gene length (bp)677
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04777 Evr1_Alr Erv1 / Alr family 1.1E-28 93 179

GO

GO Term Description Terminal node
GO:0016972 thiol oxidase activity Yes
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 63.19 31.09 95.30
Alive In ants, during behavior modification 79.11 40.64 117.58
Dead In ants, recently dead 65.97 32.40 99.53

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.327636 no
Alive Dead 0.361580 no
Dead Fungus 0.879084 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06383
MARRTHVTLMLLVGLAFFFSVSYLYSGPGSLTARDAARLLNKVRNGPSQTRPSESEAGPGFRPDLGGLPDGLLDG
ESIAPKLENATLKAELGRATWKFLHTMVAKYPEKPTPEDRKTLQLFFMAFGKLYPCGDCARHFRGLLKQMPPQTG
SRNSAAGWLCEMHNQVNKRLEKSIFDCNNIGDFYDCGCGDDKKDGKKKDEGVK*
Coding >Ophcf2|06383
ATGGCGCGTCGGACGCACGTCACCTTGATGCTCCTCGTCGGCCTCGCCTTCTTCTTCAGCGTCTCCTATCTTTAC
TCCGGGCCGGGCTCCTTGACGGCACGGGATGCCGCTCGACTGCTGAACAAGGTCCGCAACGGGCCGTCCCAGACC
CGCCCCTCCGAGTCCGAGGCCGGGCCGGGTTTCCGACCGGACCTGGGCGGTCTCCCCGATGGCCTGCTGGACGGT
GAATCCATCGCGCCCAAGCTGGAAAATGCAACCTTGAAAGCCGAACTGGGTCGCGCCACATGGAAGTTCCTACAC
ACCATGGTGGCCAAGTACCCCGAGAAGCCGACGCCGGAAGATCGCAAGACGCTGCAGCTCTTTTTCATGGCCTTT
GGCAAGCTGTACCCCTGCGGCGACTGCGCGAGACACTTCCGCGGCCTTCTCAAGCAGATGCCGCCCCAGACGGGC
AGCCGCAACTCGGCGGCTGGATGGCTATGCGAGATGCACAATCAGGTTAATAAGCGACTGGAAAAGTCCATCTTT
GACTGCAACAACATCGGCGACTTTTACGACTGCGGGTGCGGAGACGATAAAAAGGACGGAAAGAAAAAGGACGAG
GGGGTGAAGTAA
Transcript >Ophcf2|06383
ATGGCGCGTCGGACGCACGTCACCTTGATGCTCCTCGTCGGCCTCGCCTTCTTCTTCAGCGTCTCCTATCTTTAC
TCCGGGCCGGGCTCCTTGACGGCACGGGATGCCGCTCGACTGCTGAACAAGGTCCGCAACGGGCCGTCCCAGACC
CGCCCCTCCGAGTCCGAGGCCGGGCCGGGTTTCCGACCGGACCTGGGCGGTCTCCCCGATGGCCTGCTGGACGGT
GAATCCATCGCGCCCAAGCTGGAAAATGCAACCTTGAAAGCCGAACTGGGTCGCGCCACATGGAAGTTCCTACAC
ACCATGGTGGCCAAGTACCCCGAGAAGCCGACGCCGGAAGATCGCAAGACGCTGCAGCTCTTTTTCATGGCCTTT
GGCAAGCTGTACCCCTGCGGCGACTGCGCGAGACACTTCCGCGGCCTTCTCAAGCAGATGCCGCCCCAGACGGGC
AGCCGCAACTCGGCGGCTGGATGGCTATGCGAGATGCACAATCAGGTTAATAAGCGACTGGAAAAGTCCATCTTT
GACTGCAACAACATCGGCGACTTTTACGACTGCGGGTGCGGAGACGATAAAAAGGACGGAAAGAAAAAGGACGAG
GGGGTGAAGTAA
Gene >Ophcf2|06383
ATGGCGCGTCGGACGCACGTCACCTTGATGCTCCTCGTCGGCCTCGCCTTCTTCTTCAGCGTCTCCTATCTTTAC
TCCGGGCCGGGCTCCTTGACGGCACGGGATGCCGCTCGACTGCTGAACAAGGTCCGCAACGGGCCGTCCCAGACC
CGCCCCTCCGAGTCCGAGGCCGGGCCGGGTTTCCGACCGGACCTGGGCGGTCTCCCCGATGGCCTGCTGGACGGT
GAATCCATCGCGCCCAAGCTGGAAAATGCAACCTTGAAGTGAAGACCGTTGCCCCCGCTTGCCTTGTCGTCTCGG
TCCATTCTTGCTGACCCTGATCCGACAGAGCCGAACTGGGTCGCGCCACATGGAAGTTCCTACACACCATGGTGG
CCAAGTACCCCGAGAAGCCGACGCCGGAAGATCGCAAGACGCTGCAGCTCTTTTTCATGGCCTTTGGCAAGCTGT
ACCCCTGCGGCGACTGCGCGAGACACTTCCGCGGCCTTCTCAAGCAGATGCCGCCCCAGACGGGCAGCCGCAACT
CGGCGGCTGGATGGCTATGCGAGATGCACAATCAGGTTAATAAGCGACTGGAAAAGTCCATCTTTGACTGCAACA
ACATCGGCGACTTTTACGACTGCGGGTGCGGAGACGATAAAAAGGACGGAAAGAAAAAGGACGAGGGGGTGAAGT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail