Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06383
Gene name
Locationscaffold_07:2224326..2225003
Strand+
Gene length (bp)677
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04777 Evr1_Alr Erv1 / Alr family 1.1E-28 93 179

GO

GO Term Description Terminal node
GO:0016972 thiol oxidase activity Yes
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06383
MARRTHVTLMLLVGLAFFFSVSYLYSGPGSLTARDAARLLNKVRNGPSQTRPSESEAGPGFRPDLGGLPDGLLDG
ESIAPKLENATLKAELGRATWKFLHTMVAKYPEKPTPEDRKTLQLFFMAFGKLYPCGDCARHFRGLLKQMPPQTG
SRNSAAGWLCEMHNQVNKRLEKSIFDCNNIGDFYDCGCGDDKKDGKKKDEGVK*
Coding >Ophcf2|06383
ATGGCGCGTCGGACGCACGTCACCTTGATGCTCCTCGTCGGCCTCGCCTTCTTCTTCAGCGTCTCCTATCTTTAC
TCCGGGCCGGGCTCCTTGACGGCACGGGATGCCGCTCGACTGCTGAACAAGGTCCGCAACGGGCCGTCCCAGACC
CGCCCCTCCGAGTCCGAGGCCGGGCCGGGTTTCCGACCGGACCTGGGCGGTCTCCCCGATGGCCTGCTGGACGGT
GAATCCATCGCGCCCAAGCTGGAAAATGCAACCTTGAAAGCCGAACTGGGTCGCGCCACATGGAAGTTCCTACAC
ACCATGGTGGCCAAGTACCCCGAGAAGCCGACGCCGGAAGATCGCAAGACGCTGCAGCTCTTTTTCATGGCCTTT
GGCAAGCTGTACCCCTGCGGCGACTGCGCGAGACACTTCCGCGGCCTTCTCAAGCAGATGCCGCCCCAGACGGGC
AGCCGCAACTCGGCGGCTGGATGGCTATGCGAGATGCACAATCAGGTTAATAAGCGACTGGAAAAGTCCATCTTT
GACTGCAACAACATCGGCGACTTTTACGACTGCGGGTGCGGAGACGATAAAAAGGACGGAAAGAAAAAGGACGAG
GGGGTGAAGTAA
Transcript >Ophcf2|06383
ATGGCGCGTCGGACGCACGTCACCTTGATGCTCCTCGTCGGCCTCGCCTTCTTCTTCAGCGTCTCCTATCTTTAC
TCCGGGCCGGGCTCCTTGACGGCACGGGATGCCGCTCGACTGCTGAACAAGGTCCGCAACGGGCCGTCCCAGACC
CGCCCCTCCGAGTCCGAGGCCGGGCCGGGTTTCCGACCGGACCTGGGCGGTCTCCCCGATGGCCTGCTGGACGGT
GAATCCATCGCGCCCAAGCTGGAAAATGCAACCTTGAAAGCCGAACTGGGTCGCGCCACATGGAAGTTCCTACAC
ACCATGGTGGCCAAGTACCCCGAGAAGCCGACGCCGGAAGATCGCAAGACGCTGCAGCTCTTTTTCATGGCCTTT
GGCAAGCTGTACCCCTGCGGCGACTGCGCGAGACACTTCCGCGGCCTTCTCAAGCAGATGCCGCCCCAGACGGGC
AGCCGCAACTCGGCGGCTGGATGGCTATGCGAGATGCACAATCAGGTTAATAAGCGACTGGAAAAGTCCATCTTT
GACTGCAACAACATCGGCGACTTTTACGACTGCGGGTGCGGAGACGATAAAAAGGACGGAAAGAAAAAGGACGAG
GGGGTGAAGTAA
Gene >Ophcf2|06383
ATGGCGCGTCGGACGCACGTCACCTTGATGCTCCTCGTCGGCCTCGCCTTCTTCTTCAGCGTCTCCTATCTTTAC
TCCGGGCCGGGCTCCTTGACGGCACGGGATGCCGCTCGACTGCTGAACAAGGTCCGCAACGGGCCGTCCCAGACC
CGCCCCTCCGAGTCCGAGGCCGGGCCGGGTTTCCGACCGGACCTGGGCGGTCTCCCCGATGGCCTGCTGGACGGT
GAATCCATCGCGCCCAAGCTGGAAAATGCAACCTTGAAGTGAAGACCGTTGCCCCCGCTTGCCTTGTCGTCTCGG
TCCATTCTTGCTGACCCTGATCCGACAGAGCCGAACTGGGTCGCGCCACATGGAAGTTCCTACACACCATGGTGG
CCAAGTACCCCGAGAAGCCGACGCCGGAAGATCGCAAGACGCTGCAGCTCTTTTTCATGGCCTTTGGCAAGCTGT
ACCCCTGCGGCGACTGCGCGAGACACTTCCGCGGCCTTCTCAAGCAGATGCCGCCCCAGACGGGCAGCCGCAACT
CGGCGGCTGGATGGCTATGCGAGATGCACAATCAGGTTAATAAGCGACTGGAAAAGTCCATCTTTGACTGCAACA
ACATCGGCGACTTTTACGACTGCGGGTGCGGAGACGATAAAAAGGACGGAAAGAAAAAGGACGAGGGGGTGAAGT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail