Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06380
Gene name
Locationscaffold_07:2213349..2214195
Strand+
Gene length (bp)846
Transcript length (bp)600
Coding sequence length (bp)600
Protein length (aa) 200

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0616 0.0508 0.9859 0.0319 0.1028 0.0095 0.0466 0.0408 0.0376 0.0044

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999695

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup238
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6738
Ophiocordyceps australis 1348a (Ghana) OphauG2|784
Ophiocordyceps australis map64 (Brazil) OphauB2|1368
Ophiocordyceps australis map64 (Brazil) OphauB2|4853
Ophiocordyceps camponoti-floridani Ophcf2|06380 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06854
Ophiocordyceps camponoti-rufipedis Ophun1|3358
Ophiocordyceps camponoti-rufipedis Ophun1|7054
Ophiocordyceps kimflemingae Ophio5|3331
Ophiocordyceps kimflemingae Ophio5|6004
Ophiocordyceps subramaniannii Hirsu2|56
Ophiocordyceps subramaniannii Hirsu2|9193

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06380
MVRVTLATILAIASSVTAGPVAQLQGGQREGQVEVSGVAAQKGSNNRNNNRNNNNDNNDNNNNRNNNNDNNNNNN
RNNQNNNNNNNNNNNNNNRNNQNNQNNNNNNNNNNRNNQNNGNNNNNNQNGNNANAQNLQPNDPGFGEQNVGNGQ
GKQSITGGCASRADCASQCCAARNGGLECAAPGALGVQADDPQCDQRVA*
Coding >Ophcf2|06380
ATGGTTCGCGTCACCCTCGCCACCATCTTGGCCATCGCCTCCTCGGTGACTGCTGGACCAGTCGCCCAGCTTCAG
GGCGGGCAGCGAGAGGGACAGGTTGAGGTTTCGGGGGTTGCGGCGCAGAAGGGGTCGAACAACCGGAACAACAAC
AGGAACAATAACAACGACAACAACGACAACAACAACAACAGGAACAATAACAACGACAACAACAACAACAACAAC
AGGAACAACCAGAACAACAACAACAACAACAACAACAACAACAACAACAACAATAGGAACAACCAGAACAACCAG
AATAACAACAACAACAACAACAACAACAACCGAAACAACCAGAATAACGGCAACAACAACAACAACAACCAAAAC
GGCAACAACGCCAACGCCCAAAACCTCCAACCCAACGACCCCGGCTTCGGCGAGCAAAACGTCGGCAACGGCCAG
GGCAAGCAATCCATCACCGGCGGCTGCGCCTCCCGCGCCGACTGCGCGAGCCAATGCTGCGCCGCCCGCAACGGC
GGCCTCGAGTGCGCCGCCCCGGGGGCCCTGGGCGTCCAGGCCGACGATCCGCAGTGTGATCAGAGGGTTGCTTAG
Transcript >Ophcf2|06380
ATGGTTCGCGTCACCCTCGCCACCATCTTGGCCATCGCCTCCTCGGTGACTGCTGGACCAGTCGCCCAGCTTCAG
GGCGGGCAGCGAGAGGGACAGGTTGAGGTTTCGGGGGTTGCGGCGCAGAAGGGGTCGAACAACCGGAACAACAAC
AGGAACAATAACAACGACAACAACGACAACAACAACAACAGGAACAATAACAACGACAACAACAACAACAACAAC
AGGAACAACCAGAACAACAACAACAACAACAACAACAACAACAACAACAACAATAGGAACAACCAGAACAACCAG
AATAACAACAACAACAACAACAACAACAACCGAAACAACCAGAATAACGGCAACAACAACAACAACAACCAAAAC
GGCAACAACGCCAACGCCCAAAACCTCCAACCCAACGACCCCGGCTTCGGCGAGCAAAACGTCGGCAACGGCCAG
GGCAAGCAATCCATCACCGGCGGCTGCGCCTCCCGCGCCGACTGCGCGAGCCAATGCTGCGCCGCCCGCAACGGC
GGCCTCGAGTGCGCCGCCCCGGGGGCCCTGGGCGTCCAGGCCGACGATCCGCAGTGTGATCAGAGGGTTGCTTAG
Gene >Ophcf2|06380
ATGGTTCGCGTCACCCTCGCCACCATCTTGGCCAGTGAGTTTCTCTATTCTTTTTTTTTTTTTTTGGCCCCGTCG
ATTACATGCAGCGAGATGACTGACGAAGCTGGTCAGTCGCCTCCTCGGTGACTGCTGGACCAGTCGCCCAGCTTC
AGGGCGGGCAGCGAGAGGGACAGGTTGAGGTTTCGGGGGTTGCGGCGCAGAAGGGGTCGGTCTGCTGGGGGTCGG
TGGACAGGGGGTGGGCGGGCAGGTGATTGGGGGGGTTGGGGGTGTTGATGGCTTTGGAAACGGGTTGAATGTCTT
TGGGGCGGAGAGTGGGAATGGGAATGGGGGGGGGGCGGGAACAACAACAGGAATAACAACGATGACGGGAACAAC
CAGAACAACCGGAACAACAACAGGAACAATAACAACGACAACAACGACAACAACAACAACAGGAACAATAACAAC
GACAACAACAACAACAACAACAGGAACAACCAGAACAACAACAACAACAACAACAACAACAACAACAACAACAAT
AGGAACAACCAGAACAACCAGAATAACAACAACAACAACAACAACAACAACCGAAACAACCAGAATAACGGCAAC
AACAACAACAACAACCAAAACGGCAACAACGCCAACGCCCAAAACCTCCAACCCAACGACCCCGGCTTCGGCGAG
CAAAACGTCGGCAACGGCCAGGGCAAGCAATCCATCACCGGCGGCTGCGCCTCCCGCGCCGACTGCGCGAGCCAA
TGCTGCGCCGCCCGCAACGGCGGCCTCGAGTGCGCCGCCCCGGGGGCCCTGGGCGTCCAGGCCGACGATCCGCAG
TGTGATCAGAGGGTTGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail