Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06371
Gene name
Locationscaffold_07:2192872..2193604
Strand+
Gene length (bp)732
Transcript length (bp)732
Coding sequence length (bp)732
Protein length (aa) 244

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04181 RPAP2_Rtr1 Rtr1/RPAP2 family 1.2E-22 64 136

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6378 0.6709 0.0085 0.0119 0.3086 0.0066 0.0875 0.2736 0.1092 0.017

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5846
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|450
Ophiocordyceps australis map64 (Brazil) OphauB2|2568
Ophiocordyceps camponoti-floridani Ophcf2|06371 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3737
Ophiocordyceps kimflemingae Ophio5|4601

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06371
MSGLSDARQVALQHARLLQQRKDLESEILDSLLLLAEYPLVRSADRSAASPAPSDVSGFKTHVRLFQPSDYSDLV
EERNVNGLCGYALCPRPRRQAGPGGEWKITAAGDIVRRKDLEMWCSDHCARRALYVQVQLNETAAWERAGIPDIQ
IDLYDELDPTESSKSAHARLEDQRHATRDAAALALERGDRVDATKVKVAVAENEATTAPDLSTKANKARPSDHHL
LVEGHKTQLPFRPRPPNC*
Coding >Ophcf2|06371
ATGTCCGGCCTGTCCGACGCCAGGCAAGTCGCCCTGCAGCACGCCAGGCTCCTGCAGCAACGAAAGGACCTCGAG
TCCGAAATCCTCGATAGCCTCCTCCTGCTGGCCGAGTATCCGCTCGTCCGTTCGGCGGATCGTTCGGCCGCATCG
CCGGCCCCTTCGGACGTGTCGGGCTTCAAGACCCATGTTCGCCTCTTCCAGCCCTCCGACTACAGCGATCTCGTC
GAGGAGCGCAACGTCAACGGCCTCTGCGGTTACGCCCTGTGTCCGCGCCCCAGACGTCAGGCAGGCCCCGGCGGC
GAGTGGAAGATTACGGCTGCCGGCGACATCGTCAGGCGCAAGGACCTCGAGATGTGGTGCTCCGATCACTGCGCC
CGCCGTGCCCTCTACGTCCAGGTTCAGCTCAACGAGACTGCGGCTTGGGAGCGGGCCGGCATTCCCGACATACAG
ATCGACCTGTACGACGAGCTCGACCCGACAGAGAGCTCCAAGTCGGCACATGCTCGTTTGGAGGATCAAAGACAT
GCCACTCGCGATGCCGCGGCCTTGGCTCTCGAGAGAGGCGACCGTGTCGATGCCACCAAAGTCAAGGTGGCCGTC
GCTGAGAACGAGGCGACGACGGCGCCGGATCTCTCCACCAAGGCGAACAAGGCCCGTCCCTCCGACCATCATCTT
CTTGTTGAAGGGCACAAGACTCAACTGCCGTTTCGACCTCGGCCACCGAACTGCTGA
Transcript >Ophcf2|06371
ATGTCCGGCCTGTCCGACGCCAGGCAAGTCGCCCTGCAGCACGCCAGGCTCCTGCAGCAACGAAAGGACCTCGAG
TCCGAAATCCTCGATAGCCTCCTCCTGCTGGCCGAGTATCCGCTCGTCCGTTCGGCGGATCGTTCGGCCGCATCG
CCGGCCCCTTCGGACGTGTCGGGCTTCAAGACCCATGTTCGCCTCTTCCAGCCCTCCGACTACAGCGATCTCGTC
GAGGAGCGCAACGTCAACGGCCTCTGCGGTTACGCCCTGTGTCCGCGCCCCAGACGTCAGGCAGGCCCCGGCGGC
GAGTGGAAGATTACGGCTGCCGGCGACATCGTCAGGCGCAAGGACCTCGAGATGTGGTGCTCCGATCACTGCGCC
CGCCGTGCCCTCTACGTCCAGGTTCAGCTCAACGAGACTGCGGCTTGGGAGCGGGCCGGCATTCCCGACATACAG
ATCGACCTGTACGACGAGCTCGACCCGACAGAGAGCTCCAAGTCGGCACATGCTCGTTTGGAGGATCAAAGACAT
GCCACTCGCGATGCCGCGGCCTTGGCTCTCGAGAGAGGCGACCGTGTCGATGCCACCAAAGTCAAGGTGGCCGTC
GCTGAGAACGAGGCGACGACGGCGCCGGATCTCTCCACCAAGGCGAACAAGGCCCGTCCCTCCGACCATCATCTT
CTTGTTGAAGGGCACAAGACTCAACTGCCGTTTCGACCTCGGCCACCGAACTGCTGA
Gene >Ophcf2|06371
ATGTCCGGCCTGTCCGACGCCAGGCAAGTCGCCCTGCAGCACGCCAGGCTCCTGCAGCAACGAAAGGACCTCGAG
TCCGAAATCCTCGATAGCCTCCTCCTGCTGGCCGAGTATCCGCTCGTCCGTTCGGCGGATCGTTCGGCCGCATCG
CCGGCCCCTTCGGACGTGTCGGGCTTCAAGACCCATGTTCGCCTCTTCCAGCCCTCCGACTACAGCGATCTCGTC
GAGGAGCGCAACGTCAACGGCCTCTGCGGTTACGCCCTGTGTCCGCGCCCCAGACGTCAGGCAGGCCCCGGCGGC
GAGTGGAAGATTACGGCTGCCGGCGACATCGTCAGGCGCAAGGACCTCGAGATGTGGTGCTCCGATCACTGCGCC
CGCCGTGCCCTCTACGTCCAGGTTCAGCTCAACGAGACTGCGGCTTGGGAGCGGGCCGGCATTCCCGACATACAG
ATCGACCTGTACGACGAGCTCGACCCGACAGAGAGCTCCAAGTCGGCACATGCTCGTTTGGAGGATCAAAGACAT
GCCACTCGCGATGCCGCGGCCTTGGCTCTCGAGAGAGGCGACCGTGTCGATGCCACCAAAGTCAAGGTGGCCGTC
GCTGAGAACGAGGCGACGACGGCGCCGGATCTCTCCACCAAGGCGAACAAGGCCCGTCCCTCCGACCATCATCTT
CTTGTTGAAGGGCACAAGACTCAACTGCCGTTTCGACCTCGGCCACCGAACTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail