Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06364
Gene name
Locationscaffold_07:2172374..2174204
Strand-
Gene length (bp)1830
Transcript length (bp)1830
Coding sequence length (bp)1830
Protein length (aa) 610

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.5E-15 439 533
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.1E-09 535 590
PF13637 Ank_4 Ankyrin repeats (many copies) 2.1E-07 440 489
PF13637 Ank_4 Ankyrin repeats (many copies) 9.0E-09 503 556
PF13637 Ank_4 Ankyrin repeats (many copies) 1.0E-06 536 589
PF00023 Ank Ankyrin repeat 1.5E-02 503 534
PF00023 Ank Ankyrin repeat 1.5E-02 536 557
PF13857 Ank_5 Ankyrin repeats (many copies) 1.9E-06 497 543

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5134 0.3792 0.5484 0.2184 0.2387 0.1466 0.0909 0.3044 0.0934 0.0367

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup29
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7941
Ophiocordyceps australis 1348a (Ghana) OphauG2|7664
Ophiocordyceps australis 1348a (Ghana) OphauG2|6154
Ophiocordyceps australis 1348a (Ghana) OphauG2|493
Ophiocordyceps australis map64 (Brazil) OphauB2|7723
Ophiocordyceps australis map64 (Brazil) OphauB2|4369
Ophiocordyceps australis map64 (Brazil) OphauB2|5621
Ophiocordyceps australis map64 (Brazil) OphauB2|5885
Ophiocordyceps australis map64 (Brazil) OphauB2|6419
Ophiocordyceps australis map64 (Brazil) OphauB2|8148
Ophiocordyceps australis map64 (Brazil) OphauB2|7955
Ophiocordyceps camponoti-floridani Ophcf2|06364 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01523
Ophiocordyceps camponoti-rufipedis Ophun1|2142
Ophiocordyceps camponoti-rufipedis Ophun1|122
Ophiocordyceps kimflemingae Ophio5|1269
Ophiocordyceps kimflemingae Ophio5|6005
Ophiocordyceps subramaniannii Hirsu2|4851
Ophiocordyceps subramaniannii Hirsu2|4156
Ophiocordyceps subramaniannii Hirsu2|3503
Ophiocordyceps subramaniannii Hirsu2|3278
Ophiocordyceps subramaniannii Hirsu2|2833
Ophiocordyceps subramaniannii Hirsu2|10363
Ophiocordyceps subramaniannii Hirsu2|10307

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06364
MAFCKEQELEFSSVLANEAQMDNVIAQLSRNLTLLQGHLPYWSRESWEYSCFSLAFWEGFRLDFHERIDFQTQDR
VIDITNNRSGRFRGLNVTVFTKRQVLRRVRNEQETAVSAGSEKSKVTIDSTTDGWSMGAQLTAGHFQPMGLLFAQ
TGVTVSSTYSNHTTTGTQYSVVERNNFNCLPGYYCRSEAWTSYVKLSGPCVGRPKVVCNSEVLYPCEYRTPESWQ
KKVPRRWQCPQMTTYWKKACFPARYCEVVTPIVDEEGKPIVTEVFSSHPIPNFHPKPQITEYKAGVFTLGSDNYI
YDPSRQRDKYWNKDLGWHQNKAYPDLDDDVAKFVHKRPTLLKFRDGCYELKSIEWYCPSYDEETRYLAAAEVGGV
IKSPYGKPTAPAPTVEDMASCLEATAAKVSTGTDDKVTISELVEEHLRLYGTLGKLQTNTQTQLAWAVANNHASM
VTFLLLSSNVDPNAKDAAGRTALSRAVGNGNIDMTKLLLTSPRVSITIPDKKGRTPLFWAAAKGRTEVAELLLAA
EAEPTAADNKGRTPLLVAAVNGHEDVVALLLGLKTVDANMGDSEGRTPLWWAHRKGHADVVELLSSRRDLAGRHD
DAGNLTGSR*
Coding >Ophcf2|06364
ATGGCTTTCTGTAAAGAACAGGAGCTCGAATTCAGCAGCGTCCTGGCGAACGAGGCTCAGATGGATAATGTCATT
GCTCAACTGTCGCGAAACCTGACCTTGCTTCAAGGCCACCTACCGTACTGGTCCAGAGAATCGTGGGAGTATTCT
TGCTTCAGTCTGGCCTTTTGGGAGGGCTTCCGACTTGATTTCCACGAAAGGATCGACTTTCAAACTCAAGACCGA
GTCATCGACATAACCAACAACCGCAGCGGTCGCTTCCGAGGACTCAACGTTACCGTCTTTACCAAGCGCCAAGTG
CTGCGCAGGGTGAGAAACGAGCAAGAAACTGCCGTCTCGGCAGGAAGCGAAAAGTCCAAAGTCACCATAGATAGC
ACCACAGACGGCTGGTCGATGGGCGCACAGCTGACGGCAGGACACTTTCAGCCCATGGGCCTGCTATTCGCTCAG
ACGGGCGTCACCGTTTCGTCCACGTACTCGAATCACACGACGACGGGCACGCAGTATTCTGTCGTCGAGCGGAAC
AACTTCAACTGCTTGCCAGGCTACTACTGTCGTTCTGAGGCCTGGACCAGCTACGTCAAGCTGTCTGGGCCCTGT
GTAGGGCGGCCCAAGGTTGTCTGCAACAGCGAGGTTCTCTACCCGTGCGAATACCGGACGCCCGAGTCTTGGCAG
AAAAAAGTCCCCCGAAGATGGCAATGTCCGCAAATGACGACATATTGGAAGAAGGCATGTTTCCCTGCCAGGTAT
TGTGAAGTCGTGACACCGATTGTGGACGAAGAAGGCAAGCCCATCGTCACAGAAGTCTTTTCGTCTCACCCGATA
CCAAACTTCCATCCGAAGCCTCAAATAACAGAATACAAGGCTGGCGTCTTCACTCTGGGCTCTGACAACTACATA
TACGATCCCTCCCGACAGCGGGATAAATACTGGAACAAGGACCTAGGCTGGCATCAGAACAAGGCGTACCCCGAT
CTTGACGATGATGTGGCCAAGTTCGTCCACAAACGACCGACTCTCCTGAAGTTCAGGGATGGATGCTACGAGCTC
AAGTCGATTGAATGGTATTGCCCGTCATACGACGAAGAAACGCGATATCTCGCAGCAGCAGAAGTTGGAGGCGTC
ATCAAGTCTCCCTACGGGAAACCCACGGCTCCTGCGCCTACAGTAGAAGACATGGCCTCTTGCTTGGAGGCGACG
GCCGCAAAGGTCAGCACCGGGACGGACGACAAGGTCACCATTTCAGAACTCGTCGAAGAACATCTCCGGCTCTAC
GGAACTCTCGGCAAACTTCAGACCAATACCCAGACTCAGCTGGCATGGGCAGTCGCGAATAATCACGCCTCCATG
GTCACTTTCCTCCTCCTCTCATCAAACGTCGACCCCAATGCCAAAGACGCAGCCGGACGGACAGCGTTATCACGA
GCAGTCGGAAACGGAAACATCGACATGACGAAACTCCTTCTAACCTCACCCAGAGTCAGCATCACCATCCCAGAC
AAAAAAGGCCGCACGCCGCTATTTTGGGCAGCCGCCAAGGGCCGCACCGAGGTCGCCGAGCTACTCCTCGCCGCC
GAGGCCGAGCCCACCGCAGCAGATAACAAGGGCCGCACGCCCCTGCTGGTAGCAGCCGTCAACGGACACGAGGAC
GTCGTCGCCCTGCTGCTGGGTCTGAAGACGGTGGACGCCAACATGGGGGACAGCGAGGGGAGGACCCCGTTGTGG
TGGGCTCACCGAAAGGGGCACGCTGACGTTGTGGAGCTGCTGAGCTCGCGACGAGACCTGGCTGGCCGTCATGAT
GACGCGGGAAACTTGACGGGGTCTCGATGA
Transcript >Ophcf2|06364
ATGGCTTTCTGTAAAGAACAGGAGCTCGAATTCAGCAGCGTCCTGGCGAACGAGGCTCAGATGGATAATGTCATT
GCTCAACTGTCGCGAAACCTGACCTTGCTTCAAGGCCACCTACCGTACTGGTCCAGAGAATCGTGGGAGTATTCT
TGCTTCAGTCTGGCCTTTTGGGAGGGCTTCCGACTTGATTTCCACGAAAGGATCGACTTTCAAACTCAAGACCGA
GTCATCGACATAACCAACAACCGCAGCGGTCGCTTCCGAGGACTCAACGTTACCGTCTTTACCAAGCGCCAAGTG
CTGCGCAGGGTGAGAAACGAGCAAGAAACTGCCGTCTCGGCAGGAAGCGAAAAGTCCAAAGTCACCATAGATAGC
ACCACAGACGGCTGGTCGATGGGCGCACAGCTGACGGCAGGACACTTTCAGCCCATGGGCCTGCTATTCGCTCAG
ACGGGCGTCACCGTTTCGTCCACGTACTCGAATCACACGACGACGGGCACGCAGTATTCTGTCGTCGAGCGGAAC
AACTTCAACTGCTTGCCAGGCTACTACTGTCGTTCTGAGGCCTGGACCAGCTACGTCAAGCTGTCTGGGCCCTGT
GTAGGGCGGCCCAAGGTTGTCTGCAACAGCGAGGTTCTCTACCCGTGCGAATACCGGACGCCCGAGTCTTGGCAG
AAAAAAGTCCCCCGAAGATGGCAATGTCCGCAAATGACGACATATTGGAAGAAGGCATGTTTCCCTGCCAGGTAT
TGTGAAGTCGTGACACCGATTGTGGACGAAGAAGGCAAGCCCATCGTCACAGAAGTCTTTTCGTCTCACCCGATA
CCAAACTTCCATCCGAAGCCTCAAATAACAGAATACAAGGCTGGCGTCTTCACTCTGGGCTCTGACAACTACATA
TACGATCCCTCCCGACAGCGGGATAAATACTGGAACAAGGACCTAGGCTGGCATCAGAACAAGGCGTACCCCGAT
CTTGACGATGATGTGGCCAAGTTCGTCCACAAACGACCGACTCTCCTGAAGTTCAGGGATGGATGCTACGAGCTC
AAGTCGATTGAATGGTATTGCCCGTCATACGACGAAGAAACGCGATATCTCGCAGCAGCAGAAGTTGGAGGCGTC
ATCAAGTCTCCCTACGGGAAACCCACGGCTCCTGCGCCTACAGTAGAAGACATGGCCTCTTGCTTGGAGGCGACG
GCCGCAAAGGTCAGCACCGGGACGGACGACAAGGTCACCATTTCAGAACTCGTCGAAGAACATCTCCGGCTCTAC
GGAACTCTCGGCAAACTTCAGACCAATACCCAGACTCAGCTGGCATGGGCAGTCGCGAATAATCACGCCTCCATG
GTCACTTTCCTCCTCCTCTCATCAAACGTCGACCCCAATGCCAAAGACGCAGCCGGACGGACAGCGTTATCACGA
GCAGTCGGAAACGGAAACATCGACATGACGAAACTCCTTCTAACCTCACCCAGAGTCAGCATCACCATCCCAGAC
AAAAAAGGCCGCACGCCGCTATTTTGGGCAGCCGCCAAGGGCCGCACCGAGGTCGCCGAGCTACTCCTCGCCGCC
GAGGCCGAGCCCACCGCAGCAGATAACAAGGGCCGCACGCCCCTGCTGGTAGCAGCCGTCAACGGACACGAGGAC
GTCGTCGCCCTGCTGCTGGGTCTGAAGACGGTGGACGCCAACATGGGGGACAGCGAGGGGAGGACCCCGTTGTGG
TGGGCTCACCGAAAGGGGCACGCTGACGTTGTGGAGCTGCTGAGCTCGCGACGAGACCTGGCTGGCCGTCATGAT
GACGCGGGAAACTTGACGGGGTCTCGATGA
Gene >Ophcf2|06364
ATGGCTTTCTGTAAAGAACAGGAGCTCGAATTCAGCAGCGTCCTGGCGAACGAGGCTCAGATGGATAATGTCATT
GCTCAACTGTCGCGAAACCTGACCTTGCTTCAAGGCCACCTACCGTACTGGTCCAGAGAATCGTGGGAGTATTCT
TGCTTCAGTCTGGCCTTTTGGGAGGGCTTCCGACTTGATTTCCACGAAAGGATCGACTTTCAAACTCAAGACCGA
GTCATCGACATAACCAACAACCGCAGCGGTCGCTTCCGAGGACTCAACGTTACCGTCTTTACCAAGCGCCAAGTG
CTGCGCAGGGTGAGAAACGAGCAAGAAACTGCCGTCTCGGCAGGAAGCGAAAAGTCCAAAGTCACCATAGATAGC
ACCACAGACGGCTGGTCGATGGGCGCACAGCTGACGGCAGGACACTTTCAGCCCATGGGCCTGCTATTCGCTCAG
ACGGGCGTCACCGTTTCGTCCACGTACTCGAATCACACGACGACGGGCACGCAGTATTCTGTCGTCGAGCGGAAC
AACTTCAACTGCTTGCCAGGCTACTACTGTCGTTCTGAGGCCTGGACCAGCTACGTCAAGCTGTCTGGGCCCTGT
GTAGGGCGGCCCAAGGTTGTCTGCAACAGCGAGGTTCTCTACCCGTGCGAATACCGGACGCCCGAGTCTTGGCAG
AAAAAAGTCCCCCGAAGATGGCAATGTCCGCAAATGACGACATATTGGAAGAAGGCATGTTTCCCTGCCAGGTAT
TGTGAAGTCGTGACACCGATTGTGGACGAAGAAGGCAAGCCCATCGTCACAGAAGTCTTTTCGTCTCACCCGATA
CCAAACTTCCATCCGAAGCCTCAAATAACAGAATACAAGGCTGGCGTCTTCACTCTGGGCTCTGACAACTACATA
TACGATCCCTCCCGACAGCGGGATAAATACTGGAACAAGGACCTAGGCTGGCATCAGAACAAGGCGTACCCCGAT
CTTGACGATGATGTGGCCAAGTTCGTCCACAAACGACCGACTCTCCTGAAGTTCAGGGATGGATGCTACGAGCTC
AAGTCGATTGAATGGTATTGCCCGTCATACGACGAAGAAACGCGATATCTCGCAGCAGCAGAAGTTGGAGGCGTC
ATCAAGTCTCCCTACGGGAAACCCACGGCTCCTGCGCCTACAGTAGAAGACATGGCCTCTTGCTTGGAGGCGACG
GCCGCAAAGGTCAGCACCGGGACGGACGACAAGGTCACCATTTCAGAACTCGTCGAAGAACATCTCCGGCTCTAC
GGAACTCTCGGCAAACTTCAGACCAATACCCAGACTCAGCTGGCATGGGCAGTCGCGAATAATCACGCCTCCATG
GTCACTTTCCTCCTCCTCTCATCAAACGTCGACCCCAATGCCAAAGACGCAGCCGGACGGACAGCGTTATCACGA
GCAGTCGGAAACGGAAACATCGACATGACGAAACTCCTTCTAACCTCACCCAGAGTCAGCATCACCATCCCAGAC
AAAAAAGGCCGCACGCCGCTATTTTGGGCAGCCGCCAAGGGCCGCACCGAGGTCGCCGAGCTACTCCTCGCCGCC
GAGGCCGAGCCCACCGCAGCAGATAACAAGGGCCGCACGCCCCTGCTGGTAGCAGCCGTCAACGGACACGAGGAC
GTCGTCGCCCTGCTGCTGGGTCTGAAGACGGTGGACGCCAACATGGGGGACAGCGAGGGGAGGACCCCGTTGTGG
TGGGCTCACCGAAAGGGGCACGCTGACGTTGTGGAGCTGCTGAGCTCGCGACGAGACCTGGCTGGCCGTCATGAT
GACGCGGGAAACTTGACGGGGTCTCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail