Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06354
Gene name
Locationscaffold_07:2084954..2090507
Strand-
Gene length (bp)5553
Transcript length (bp)4176
Coding sequence length (bp)4176
Protein length (aa) 1392

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 2.5E-77 403 675
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 1.3E-43 31 181
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 2.1E-30 204 391
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 1.1E-28 768 863

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 109 131 22
3 160 179 19
4 406 428 22
5 448 470 22
6 502 524 22
7 550 572 22
8 593 615 22
9 619 641 22
10 661 695 34
11 1229 1251 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06354
MVSFIDWLKDNLSKGSDSDKTASQPESISGMISTLVPALIPALAFLLVFLFFRRSQRRFYAPRTYLGSLPHNERS
PDLPGGWLNWIGPFAKIPDVYALTHQGLDSYLFLRFLRVATTIALVSLLITWPILFPINATGGGDKSQLEILSYS
NISIANKDRLYAHAFVAWLVYGFVLYMIMRECIFYINLRQAYLLTPQYSRRISSRTVLFTAVPDDSLDEARIRAM
FRDTVRHVWIVGRSDQLTDLVDERDKVAMKMEKAQVSLIKMVNKARLKAASKNPDVSVVPAHADNVASRYVPDKK
RPSHRTGPLGLVGKKVDTIDWCRGELRRLIPEAQRGQDEWRAGKFDPVRAVFVEFETQADAQAAHQTLTHHRALR
MCPKVVGVKPSEVVWKSLEIPWWQVVVRRYAVYAFISALILFWAIPVAVIGLITQVKTLMQLPGLGWLGDIPGPI
LGVVSGLLPAVAMSIVLSLVPVLMRWCAKLAGAPTLSRAELFTQNAYFAFQVIQLFLVQTVFSSGIAALLGIVGN
PSSVFSVLGQQLPTASNFYISYFIVQGITVATGVVTQVIGLVVFRVLYKLLASTPRAMYTKWTTLTPVLWGSLMP
VYTNIVTISIIFSVIAPLVLFWSTLALVLFHLAYRYNILFVSQTAVDTQGLIYPRALKQLFTGIYLAEICMIGLF
AVVTAVGPAVLMAIFLVFTILFQITLFKNLDPLLYGLPRSVQATEHVIRTASTTGPDGTVKAGEDGKTATLSREQ
SRGSAAQREARGNAVMRFLKPWRYARYETLRDMMPREEDLGFDRLYTEETEATAYLPPSVSRQPPTIWIPEDVAG
VSKQEIALTSKVIAITDEGASLDDKNHIVWDTEGARPPVWDERVLSSASACGENTPNTTCHGRDVALVLSQSRLL
ALDYGSGAEFEAGSRLRTVGDATTPFADAEAVGAARAADGKLLVLAGGCRASSPPTVWSWDPDGREKGWLRGVVE
GGGGDVVAPPMVMGATLAFSATLAPVMDRPSIYSYGGVCLDDEEHDSDEDWQASGNYSKTMRRVTPDGDRGYVVG
TAAASSPRTAMAGFSLTALPTSTTNTSGTVTQRASFVLLGGHTSTAFINMSTAAVWSLPEEAWTYVSISGDAPDS
RSGHSCVVSADGRRLVVLGGWVGDVRTAARPQLVVLTRGGTGAYSEWRKIGHDVRGGEEMGLRFLNLSSMEWLSS
YRYDRARMEVEPAAPELSGSGPSVRRLGLGLGLGLGLALILAFLIALCAWIQRRRRRRRRRHRRQLGGHLDAQAH
GIETDAFSWRRKQAYGAVPARKPLPSEARFDAFISPPGVIHPILEEVPGSDDEGGKGPGGGGAGRGPSGAGAGGS
VCFAGEEVGSRGQGVGRWGWALDGQGRDAGGVVDVAAGVFA*
Coding >Ophcf2|06354
ATGGTCTCCTTCATCGACTGGCTCAAGGACAACTTGTCCAAGGGCTCGGACTCGGACAAGACGGCATCCCAGCCA
GAGTCCATCTCGGGCATGATTTCGACCCTCGTCCCCGCCCTGATTCCCGCCCTCGCCTTCTTGCTCGTCTTCCTC
TTCTTTCGCAGATCGCAACGCAGATTCTACGCGCCCAGGACCTATCTAGGTTCCCTGCCTCACAATGAACGAAGC
CCTGACCTGCCTGGCGGCTGGCTCAACTGGATCGGCCCCTTTGCCAAGATACCCGACGTCTACGCCCTCACCCAT
CAAGGCCTCGACTCGTACCTCTTCCTCCGATTCCTACGCGTCGCCACTACCATTGCCCTCGTCAGCCTCCTAATC
ACCTGGCCCATCCTCTTCCCCATCAATGCCACTGGTGGCGGTGACAAGTCGCAGCTCGAGATCCTGTCGTACAGC
AACATCAGCATCGCCAACAAGGACCGCCTCTACGCCCACGCCTTCGTCGCATGGCTCGTCTACGGCTTCGTTCTC
TACATGATCATGCGCGAGTGCATCTTCTACATCAACTTGCGACAGGCCTACCTGCTCACTCCCCAGTACTCCCGT
CGCATCTCCTCCCGCACCGTCCTCTTCACCGCCGTTCCCGACGATTCTCTCGACGAGGCTCGCATCCGCGCCATG
TTCCGCGACACGGTCCGCCACGTCTGGATCGTCGGCCGGTCGGACCAGCTGACGGATCTCGTCGACGAGCGCGAC
AAGGTGGCCATGAAGATGGAAAAGGCCCAGGTCAGCCTCATCAAGATGGTCAACAAGGCCCGACTCAAGGCCGCC
AGCAAGAACCCCGACGTCTCCGTCGTCCCCGCCCACGCCGACAACGTCGCCTCCCGTTACGTTCCGGACAAGAAG
CGGCCCTCGCACCGGACTGGACCCCTGGGACTCGTTGGCAAAAAGGTCGACACCATCGACTGGTGCCGCGGAGAG
CTCAGGAGGCTCATCCCCGAGGCTCAGCGCGGCCAGGACGAGTGGCGCGCCGGTAAATTCGACCCTGTCCGAGCC
GTCTTTGTCGAGTTCGAGACGCAGGCCGACGCCCAGGCCGCCCATCAGACTCTCACCCACCACCGAGCCCTCCGC
ATGTGCCCCAAGGTGGTCGGTGTCAAGCCCAGCGAGGTGGTGTGGAAGAGCCTCGAGATTCCGTGGTGGCAGGTC
GTCGTCCGCCGATACGCCGTCTACGCCTTCATCAGCGCCCTCATCCTCTTCTGGGCCATTCCCGTCGCCGTCATA
GGCCTCATCACCCAGGTCAAGACGCTGATGCAGCTGCCCGGCCTCGGCTGGCTCGGTGACATTCCCGGCCCCATC
CTCGGCGTCGTCTCGGGCCTCTTGCCGGCCGTGGCCATGTCCATCGTGCTCTCGCTCGTTCCCGTCCTCATGCGT
TGGTGCGCCAAGCTCGCCGGTGCCCCGACGCTGTCCCGGGCCGAGCTCTTCACCCAGAACGCCTACTTCGCCTTT
CAGGTCATCCAGCTCTTCCTCGTCCAGACCGTCTTCAGCTCGGGCATCGCCGCCCTCCTCGGCATCGTCGGCAAC
CCGTCGAGCGTCTTTAGCGTCCTGGGCCAGCAGTTGCCGACTGCGTCCAACTTTTACATCTCCTACTTCATCGTG
CAGGGCATCACGGTGGCGACGGGCGTCGTGACGCAGGTCATCGGCCTCGTCGTCTTCCGCGTACTCTACAAGCTC
CTGGCCTCGACGCCTCGCGCCATGTACACCAAGTGGACGACGCTGACGCCCGTGCTTTGGGGGTCCCTGATGCCC
GTCTACACCAACATCGTCACCATTAGCATCATCTTCTCCGTCATCGCGCCCCTGGTGCTGTTCTGGTCGACGCTG
GCCCTGGTGCTCTTCCACCTGGCGTACCGCTACAACATCCTGTTCGTGTCTCAGACGGCCGTCGACACGCAGGGT
CTCATCTACCCACGCGCGCTCAAGCAGCTGTTTACGGGCATTTACCTGGCCGAGATTTGCATGATCGGCCTGTTC
GCCGTGGTCACGGCGGTCGGGCCGGCGGTCCTCATGGCCATCTTCCTCGTCTTCACCATCCTCTTCCAGATCACG
CTCTTCAAGAACCTCGACCCGCTGCTATACGGACTGCCTCGCAGCGTGCAGGCGACGGAGCACGTGATACGCACC
GCCTCGACGACGGGGCCCGACGGGACGGTCAAGGCCGGCGAGGACGGCAAGACGGCGACGCTGTCGAGGGAACAG
TCACGGGGCAGCGCGGCGCAGAGGGAGGCTCGGGGCAACGCGGTGATGCGCTTCCTGAAGCCGTGGCGGTACGCG
CGGTACGAGACGCTGCGAGACATGATGCCGCGCGAAGAGGATCTCGGCTTCGACCGGCTGTACACGGAGGAGACG
GAAGCGACGGCATACCTCCCTCCGTCTGTCAGCCGACAGCCGCCGACGATTTGGATCCCGGAGGACGTGGCGGGC
GTGTCGAAGCAGGAGATTGCGCTGACGAGCAAGGTCATAGCCATCACGGACGAGGGGGCGTCGCTCGACGACAAG
AACCACATCGTGTGGGATACGGAGGGGGCTCGGCCGCCGGTATGGGATGAGAGGGTCCTCAGCTCAGCATCAGCC
TGCGGCGAGAACACTCCCAACACGACCTGCCACGGCCGAGACGTAGCCCTCGTCCTCTCGCAATCCCGCCTGCTA
GCCCTCGACTACGGATCCGGAGCCGAGTTCGAGGCCGGGTCCCGACTCCGGACCGTCGGCGACGCGACGACTCCC
TTTGCCGATGCCGAGGCCGTCGGCGCCGCGAGGGCCGCTGACGGAAAGCTCCTCGTCCTAGCGGGCGGTTGTCGA
GCTTCGTCTCCGCCGACGGTCTGGAGTTGGGATCCCGATGGGAGAGAAAAGGGATGGCTTAGAGGCGTCGTCGAG
GGAGGCGGTGGTGATGTCGTCGCGCCTCCCATGGTCATGGGCGCTACCTTGGCCTTCTCAGCCACCTTGGCGCCC
GTCATGGATCGGCCCTCGATATACTCGTACGGTGGCGTCTGTCTGGATGATGAGGAACACGACTCGGACGAGGAC
TGGCAGGCCAGCGGCAACTACTCCAAGACGATGAGAAGGGTGACACCAGACGGGGATCGAGGCTACGTCGTCGGC
ACGGCAGCCGCGTCCTCACCCCGAACAGCAATGGCAGGATTCAGCCTCACTGCCCTCCCGACCTCGACGACCAAT
ACGTCGGGAACGGTGACGCAGCGCGCGAGCTTCGTCCTCTTGGGCGGACACACGAGCACGGCCTTCATCAACATG
AGCACGGCAGCCGTCTGGTCCCTCCCCGAAGAGGCCTGGACGTACGTGTCCATCAGTGGCGACGCGCCGGATAGT
CGGTCGGGACATAGCTGTGTCGTCAGCGCGGATGGGCGCCGTCTCGTCGTCTTGGGCGGTTGGGTCGGAGATGTG
CGGACGGCGGCGAGGCCTCAGCTCGTCGTTTTGACGAGGGGGGGGACCGGAGCCTATAGCGAGTGGAGGAAGATT
GGTCATGATGTTCGGGGGGGGGAGGAGATGGGGTTGCGGTTCCTTAACCTGTCTTCCATGGAGTGGCTTTCTTCC
TATCGCTACGACCGGGCCCGGATGGAGGTGGAACCAGCGGCGCCGGAGCTGAGCGGAAGCGGACCTTCGGTTCGG
CGACTGGGACTCGGTCTCGGTCTCGGTCTCGGCCTGGCACTTATACTGGCCTTTCTCATCGCCCTCTGCGCCTGG
ATCCAGCGTCGTCGTCGTCGTCGTCGTCGTCGTCACCGTCGCCAGCTCGGAGGTCATCTCGACGCCCAAGCCCAC
GGCATCGAAACCGACGCCTTCTCCTGGCGACGAAAGCAAGCCTACGGCGCCGTCCCCGCCCGCAAGCCCCTCCCA
TCCGAGGCACGTTTCGACGCCTTCATCTCTCCTCCCGGCGTGATCCATCCTATCCTCGAGGAGGTTCCGGGGTCG
GATGACGAGGGGGGGAAGGGACCGGGAGGAGGAGGAGCGGGAAGAGGACCAAGTGGAGCGGGAGCGGGAGGATCC
GTTTGCTTCGCCGGGGAGGAGGTTGGATCCCGAGGTCAGGGAGTGGGTCGATGGGGATGGGCTCTTGATGGCCAG
GGTCGGGACGCAGGGGGGGTTGTTGATGTTGCCGCGGGAGTCTTCGCCTGA
Transcript >Ophcf2|06354
ATGGTCTCCTTCATCGACTGGCTCAAGGACAACTTGTCCAAGGGCTCGGACTCGGACAAGACGGCATCCCAGCCA
GAGTCCATCTCGGGCATGATTTCGACCCTCGTCCCCGCCCTGATTCCCGCCCTCGCCTTCTTGCTCGTCTTCCTC
TTCTTTCGCAGATCGCAACGCAGATTCTACGCGCCCAGGACCTATCTAGGTTCCCTGCCTCACAATGAACGAAGC
CCTGACCTGCCTGGCGGCTGGCTCAACTGGATCGGCCCCTTTGCCAAGATACCCGACGTCTACGCCCTCACCCAT
CAAGGCCTCGACTCGTACCTCTTCCTCCGATTCCTACGCGTCGCCACTACCATTGCCCTCGTCAGCCTCCTAATC
ACCTGGCCCATCCTCTTCCCCATCAATGCCACTGGTGGCGGTGACAAGTCGCAGCTCGAGATCCTGTCGTACAGC
AACATCAGCATCGCCAACAAGGACCGCCTCTACGCCCACGCCTTCGTCGCATGGCTCGTCTACGGCTTCGTTCTC
TACATGATCATGCGCGAGTGCATCTTCTACATCAACTTGCGACAGGCCTACCTGCTCACTCCCCAGTACTCCCGT
CGCATCTCCTCCCGCACCGTCCTCTTCACCGCCGTTCCCGACGATTCTCTCGACGAGGCTCGCATCCGCGCCATG
TTCCGCGACACGGTCCGCCACGTCTGGATCGTCGGCCGGTCGGACCAGCTGACGGATCTCGTCGACGAGCGCGAC
AAGGTGGCCATGAAGATGGAAAAGGCCCAGGTCAGCCTCATCAAGATGGTCAACAAGGCCCGACTCAAGGCCGCC
AGCAAGAACCCCGACGTCTCCGTCGTCCCCGCCCACGCCGACAACGTCGCCTCCCGTTACGTTCCGGACAAGAAG
CGGCCCTCGCACCGGACTGGACCCCTGGGACTCGTTGGCAAAAAGGTCGACACCATCGACTGGTGCCGCGGAGAG
CTCAGGAGGCTCATCCCCGAGGCTCAGCGCGGCCAGGACGAGTGGCGCGCCGGTAAATTCGACCCTGTCCGAGCC
GTCTTTGTCGAGTTCGAGACGCAGGCCGACGCCCAGGCCGCCCATCAGACTCTCACCCACCACCGAGCCCTCCGC
ATGTGCCCCAAGGTGGTCGGTGTCAAGCCCAGCGAGGTGGTGTGGAAGAGCCTCGAGATTCCGTGGTGGCAGGTC
GTCGTCCGCCGATACGCCGTCTACGCCTTCATCAGCGCCCTCATCCTCTTCTGGGCCATTCCCGTCGCCGTCATA
GGCCTCATCACCCAGGTCAAGACGCTGATGCAGCTGCCCGGCCTCGGCTGGCTCGGTGACATTCCCGGCCCCATC
CTCGGCGTCGTCTCGGGCCTCTTGCCGGCCGTGGCCATGTCCATCGTGCTCTCGCTCGTTCCCGTCCTCATGCGT
TGGTGCGCCAAGCTCGCCGGTGCCCCGACGCTGTCCCGGGCCGAGCTCTTCACCCAGAACGCCTACTTCGCCTTT
CAGGTCATCCAGCTCTTCCTCGTCCAGACCGTCTTCAGCTCGGGCATCGCCGCCCTCCTCGGCATCGTCGGCAAC
CCGTCGAGCGTCTTTAGCGTCCTGGGCCAGCAGTTGCCGACTGCGTCCAACTTTTACATCTCCTACTTCATCGTG
CAGGGCATCACGGTGGCGACGGGCGTCGTGACGCAGGTCATCGGCCTCGTCGTCTTCCGCGTACTCTACAAGCTC
CTGGCCTCGACGCCTCGCGCCATGTACACCAAGTGGACGACGCTGACGCCCGTGCTTTGGGGGTCCCTGATGCCC
GTCTACACCAACATCGTCACCATTAGCATCATCTTCTCCGTCATCGCGCCCCTGGTGCTGTTCTGGTCGACGCTG
GCCCTGGTGCTCTTCCACCTGGCGTACCGCTACAACATCCTGTTCGTGTCTCAGACGGCCGTCGACACGCAGGGT
CTCATCTACCCACGCGCGCTCAAGCAGCTGTTTACGGGCATTTACCTGGCCGAGATTTGCATGATCGGCCTGTTC
GCCGTGGTCACGGCGGTCGGGCCGGCGGTCCTCATGGCCATCTTCCTCGTCTTCACCATCCTCTTCCAGATCACG
CTCTTCAAGAACCTCGACCCGCTGCTATACGGACTGCCTCGCAGCGTGCAGGCGACGGAGCACGTGATACGCACC
GCCTCGACGACGGGGCCCGACGGGACGGTCAAGGCCGGCGAGGACGGCAAGACGGCGACGCTGTCGAGGGAACAG
TCACGGGGCAGCGCGGCGCAGAGGGAGGCTCGGGGCAACGCGGTGATGCGCTTCCTGAAGCCGTGGCGGTACGCG
CGGTACGAGACGCTGCGAGACATGATGCCGCGCGAAGAGGATCTCGGCTTCGACCGGCTGTACACGGAGGAGACG
GAAGCGACGGCATACCTCCCTCCGTCTGTCAGCCGACAGCCGCCGACGATTTGGATCCCGGAGGACGTGGCGGGC
GTGTCGAAGCAGGAGATTGCGCTGACGAGCAAGGTCATAGCCATCACGGACGAGGGGGCGTCGCTCGACGACAAG
AACCACATCGTGTGGGATACGGAGGGGGCTCGGCCGCCGGTATGGGATGAGAGGGTCCTCAGCTCAGCATCAGCC
TGCGGCGAGAACACTCCCAACACGACCTGCCACGGCCGAGACGTAGCCCTCGTCCTCTCGCAATCCCGCCTGCTA
GCCCTCGACTACGGATCCGGAGCCGAGTTCGAGGCCGGGTCCCGACTCCGGACCGTCGGCGACGCGACGACTCCC
TTTGCCGATGCCGAGGCCGTCGGCGCCGCGAGGGCCGCTGACGGAAAGCTCCTCGTCCTAGCGGGCGGTTGTCGA
GCTTCGTCTCCGCCGACGGTCTGGAGTTGGGATCCCGATGGGAGAGAAAAGGGATGGCTTAGAGGCGTCGTCGAG
GGAGGCGGTGGTGATGTCGTCGCGCCTCCCATGGTCATGGGCGCTACCTTGGCCTTCTCAGCCACCTTGGCGCCC
GTCATGGATCGGCCCTCGATATACTCGTACGGTGGCGTCTGTCTGGATGATGAGGAACACGACTCGGACGAGGAC
TGGCAGGCCAGCGGCAACTACTCCAAGACGATGAGAAGGGTGACACCAGACGGGGATCGAGGCTACGTCGTCGGC
ACGGCAGCCGCGTCCTCACCCCGAACAGCAATGGCAGGATTCAGCCTCACTGCCCTCCCGACCTCGACGACCAAT
ACGTCGGGAACGGTGACGCAGCGCGCGAGCTTCGTCCTCTTGGGCGGACACACGAGCACGGCCTTCATCAACATG
AGCACGGCAGCCGTCTGGTCCCTCCCCGAAGAGGCCTGGACGTACGTGTCCATCAGTGGCGACGCGCCGGATAGT
CGGTCGGGACATAGCTGTGTCGTCAGCGCGGATGGGCGCCGTCTCGTCGTCTTGGGCGGTTGGGTCGGAGATGTG
CGGACGGCGGCGAGGCCTCAGCTCGTCGTTTTGACGAGGGGGGGGACCGGAGCCTATAGCGAGTGGAGGAAGATT
GGTCATGATGTTCGGGGGGGGGAGGAGATGGGGTTGCGGTTCCTTAACCTGTCTTCCATGGAGTGGCTTTCTTCC
TATCGCTACGACCGGGCCCGGATGGAGGTGGAACCAGCGGCGCCGGAGCTGAGCGGAAGCGGACCTTCGGTTCGG
CGACTGGGACTCGGTCTCGGTCTCGGTCTCGGCCTGGCACTTATACTGGCCTTTCTCATCGCCCTCTGCGCCTGG
ATCCAGCGTCGTCGTCGTCGTCGTCGTCGTCGTCACCGTCGCCAGCTCGGAGGTCATCTCGACGCCCAAGCCCAC
GGCATCGAAACCGACGCCTTCTCCTGGCGACGAAAGCAAGCCTACGGCGCCGTCCCCGCCCGCAAGCCCCTCCCA
TCCGAGGCACGTTTCGACGCCTTCATCTCTCCTCCCGGCGTGATCCATCCTATCCTCGAGGAGGTTCCGGGGTCG
GATGACGAGGGGGGGAAGGGACCGGGAGGAGGAGGAGCGGGAAGAGGACCAAGTGGAGCGGGAGCGGGAGGATCC
GTTTGCTTCGCCGGGGAGGAGGTTGGATCCCGAGGTCAGGGAGTGGGTCGATGGGGATGGGCTCTTGATGGCCAG
GGTCGGGACGCAGGGGGGGTTGTTGATGTTGCCGCGGGAGTCTTCGCCTGA
Gene >Ophcf2|06354
ATGGTCTCCTTCATCGACTGGCTCAAGGACAACTTGTCCAAGGGCTCGGACTCGGACAAGACGGCATCCCAGCCA
GAGTCCATCTCGGGTCCGTCTGCTTCACTCGCCTCTTCTCGCTGTCTTTTTCCCCCCGTCACTGACTCTGACAAG
GCATGATTTCGACCCTCGTCCCCGCCCTGATTCCCGCCCTCGCCTTCTTGCTCGTCTTCCTCTTCTTTCGCAGAT
CGCAACGCAGATTCTACGCGCCCAGGACCTATCTAGGTTCCCTGCCTCACAAGTGAGTCGTCGTCATCGCCCCCT
CGGTCTGTCACGTCCGTCACCCCCTAACACAACCGTCTCCAGTGAACGAAGCCCTGACCTGCCTGGCGGCTGGCT
CAACTGGATCGGCCCCTTTGCCAAGATACCCGACGTCTACGCCCTCACCCATCAAGGCCTCGACTCGTACCTCTT
CCTCCGATTCCTACGCGTCGCCACTACCATTGCCCTCGTCAGCCTCCTAATCACCTGGCCCATCCTCTTCCCCAT
CAATGCCACTGGTGGCGGTGACAAGTCGCAGCTCGAGATCCTGTCGTACAGCAACATCAGCATCGCCAACAAGGA
CCGCCTCTACGCCCACGCCTTCGTCGCATGGCTCGTCTACGGCTTCGTTCTCTACATGATCATGCGCGAGTGCAT
CTTCTACATCAACTTGCGACAGGCCTACCTGCTCACTCCCCAGTACTCCCGTCGCATCTCCTCCCGCACCGTCCT
CTTCACCGCCGTTCCCGACGATTCTCTCGACGAGGCTCGCATCCGCGCCATGTTCCGCGACACGGTCCGCCACGT
CTGGATCGTCGGCCGGTCGGACCAGCTGACGGATCTCGTCGACGAGCGCGACAAGGTGGCCATGAAGATGGAAAA
GGCCCAGGTCAGCCTCATCAAGATGGTCAACAAGGCCCGACTCAAGGCCGCCAGCAAGAACCCCGACGTCTCCGT
CGTCCCCGCCCACGCCGACAACGTCGCCTCCCGTTACGTTCCGGACAAGAAGCGGCCCTCGCACCGGACTGGACC
CCTGGGACTCGTTGGCAAAAAGGTCGACACCATCGACTGGTGCCGCGGAGAGCTCAGGAGGCTCATCCCCGAGGC
TCAGCGCGGCCAGGACGAGTGGCGCGCCGGTAAATTCGACCCTGTCCGAGCCGTCTTTGTCGAGTTCGAGACGCA
GGCCGACGCCCAGGCCGCCCATCAGACTCTCACCCACCACCGAGCCCTCCGCATGTGCCCCAAGGTGGTCGGTGT
CAAGCCCAGCGAGGTGGTGTGGAAGAGCCTCGAGATTCCGTGGTGGCAGGTCGTCGTCCGCCGATACGCCGTCTA
CGCCTTCATCAGCGCCCTCATCCTCTTCTGGGCCATTCCCGTCGCCGTCATAGGCCTCATCACCCAGGTCAAGAC
GCTGATGCAGCTGCCCGGCCTCGGCTGGCTCGGTGACATTCCCGGCGTGAGTCGTCGTCGTCGTCGTCGTCGTCG
TCGTCGTCCCTCGTCTCCCGTCTTCCTCACCTGTCTGACTGACTCTACTCACAGCCCATCCTCGGCGTCGTCTCG
GGCCTCTTGCCGGCCGTGGCCATGTCCATCGTGCTCTCGCTCGTTCCCGTCCTCATGCGTTGGTGCGCCAAGCTC
GCCGGTGCCCCGACGCTGTCCCGGGCCGAGCTCTTCACCCAGAACGCCTACTTCGCCTTTCAGGTCATCCAGCTC
TTCCTCGTCCAGACCGTCTTCAGCTCGGGCATCGCCGCCCTCCTCGGCATCGTCGGCAACCCGTCGAGCGTCTTT
AGCGTCCTGGGCCAGCAGTTGCCGACTGCGTCCAACTTTTACATCTCCTACTTCATCGTGCAGGGCATCACGGTG
GCGACGGGCGTCGTGACGCAGGTCATCGGCCTCGTCGTCTTCCGCGTACTCTACAAGCTCCTGGCCTCGACGCCT
CGCGCCATGTACACCAAGTGGACGACGCTGACGCCCGTGCTTTGGGGGTCCCTGATGCCCGTCTACACCAACATC
GTCACCATTAGTGAGTGGCCCGTGATCCTTTGTTGACGCGTCGCGTGCCCGCTGACGACGGGGGGCCAGGCATCA
TCTTCTCCGTCATCGCGCCCCTGGTGCTGTTCTGGTCGACGCTGGCCCTGGTGCTCTTCCACCTGGCGTACCGCT
ACAACATCCTGTTCGTGTCTCAGACGGCCGTCGACACGCAGGGTCTCATCTACCCACGCGCGCTCAAGCAGCTGT
TTACGGGCATTTACCTGGCCGAGATTTGCATGATCGGCCTGTTCGCCGTGGTCACGGCGGTCGGGCCGGCGGTCC
TCATGGCCATCTTCCTCGTCTTCACCATCCTCTTCCAGATCACGCTCTTCAAGAACCTCGACCCGCTGCTATACG
GACTGCCTCGCAGCGTGCAGGCGACGGAGCACGTGATACGCACCGCCTCGACGACGGGGCCCGACGGGACGGTCA
AGGCCGGCGAGGACGGCAAGACGGCGACGCTGTCGAGGGAACAGTCACGGGGCAGCGCGGCGCAGAGGGAGGCTC
GGGGCAACGCGGTGATGCGCTTCCTGAAGCCGTGGCGGTACGCGCGGTACGAGACGCTGCGAGACATGATGCCGC
GCGAAGAGGATCTCGGCTTCGACCGGCTGTACACGGAGGAGACGGAAGCGACGGCATACCTCCCTCCGTCTGTCA
GCCGACAGCCGCCGACGATTTGGATCCCGGAGGACGTGGCGGGCGTGTCGAAGCAGGAGATTGCGCTGACGAGCA
AGGTCATAGCCATCACGGACGAGGGGGCGTCGCTCGACGACAAGAACCACATCGTGTGGGATACGGAGGGGGCTC
GGCCGCCGGTATGGGATGAGAGGGTATATTATTGAGGAGGAGTTTAATTCGCGTAGGAGGGATTCTCGTCTGCTT
GTCGGACGAGACGAGTTCTACTGCTCGTCTGTATGTATGGATGGACAAGAAGCGACACCTATATCAGGATCAATA
CTTTAATTAACAAGACTACCTTTTCTATCGTCATGTACATATAGTTCGTGCCCTAGTAGAAGGGGTCGAGTTGGT
TGCTCGTGTCTCGGGAGGTCGAGATGCTAGACATACATACATGAGGTCTAGATAACCTCCATCATCTCTGTGCTG
AGACTCTGCAGTATCCAAAGGTTGGGATGGAGTTCGATTACATACACAGTCTAGCGGTCGAGGAGGGGCTGAGTA
ATCCGAACCTCTCCCATCACCGAGGCAACGGACCACAAGCAAGGCCTAAAGCTAAAAAAGAAAAAAAACGGGCGC
GTGTGAATGTTGAATGGATGGGAGGGAAGCGGCTGTTGGACGGGCGTTTTGCACGTGTAGCGCGAGCTGTTGTCC
GCTGTATTCGTCAAGACTTGGCGGTTAGGTGCGTGGTCTGGCCGATTCGCACATATACATACATACATACATGTT
ATGTTGTTGGGGCTGGTTGGTAGTAGGTAGGTAGGTAGGTTTGGGAGGCGCCGGCTGGGGCTTTGTTCTGTTCGG
CTTGATCCTTTGCTTACTTTGGTTGTTTTGGTTGGCGGAGAGTCGGCGTATCTCTTGTCTGGTCACGATCTGGGA
TGCTATCTTGCTCGTTGCTGAGGAGTGGCATCTTTGCTCTGCTTGTTTACCGTTGATCGCGACTCTTCTCTTTTA
CCGTCTATCCATCCATCACCACTCCCGCATCTGCCTTTTCATCATCCAACCCGTCACCTGTCTCTCGTCTCTCCT
CTTCACGATTCCTCTTCACGACTCCTCTTCACGATTCGTCAAACACCTCCTCCTGTCATGCCATTTCTCCTCTCC
CCCTAAACCACTCGACATGCCTCACGCGACCACGCAGGTCCTCAGCTCAGCATCAGCCTGCGGCGAGAACACTCC
CAACACGACCTGCCACGGCCGAGACGTAGCCCTCGTCCTCTCGCAATCCCGCCTGCTAGCCCTCGACTACGGATC
CGGAGCCGAGTTCGAGGCCGGGTCCCGACTCCGGACCGTCGGCGACGCGACGACTCCCTTTGCCGATGCCGAGGC
CGTCGGCGCCGCGAGGGCCGCTGACGGAAAGCTCCTCGTCCTAGCGGGCGGTTGTCGAGCTTCGTCTCCGCCGAC
GGTCTGGAGTTGGGATCCCGATGGGAGAGAAAAGGGATGGCTTAGAGGCGTCGTCGAGGGAGGCGGTGGTGATGT
CGTCGCGCCTCCCATGGTCATGGGCGCTACCTTGGCCTTCTCAGCCACCTTGGCGCCCGTCATGGATCGGCCCTC
GATATACTCGTACGGTGGCGTCTGTCTGGATGATGAGGAACACGACTCGGACGAGGACTGGCAGGCCAGCGGCAA
CTACTCCAAGACGATGAGAAGGGTGACACCAGACGGGGATCGAGGCTACGTCGTCGGCACGGCAGCCGCGTCCTC
ACCCCGAACAGCAATGGCAGGATTCAGCCTCACTGCCCTCCCGACCTCGACGACCAATACGTCGGGAACGGTGAC
GCAGCGCGCGAGCTTCGTCCTCTTGGGCGGACACACGAGCACGGCCTTCATCAACATGAGCACGGCAGCCGTCTG
GTCCCTCCCCGAAGAGGCCTGGACGTACGTGTCCATCAGTGGCGACGCGCCGGATAGTCGGTCGGGACATAGCTG
TGTCGTCAGCGCGGATGGGCGCCGTCTCGTCGTCTTGGGCGGTTGGGTCGGAGATGTGCGGACGGCGGCGAGGCC
TCAGCTCGTCGTTTTGACGAGGGGGGGGACCGGAGCCTATAGCGAGTGGAGGTGGGCTTCTGTGGTGCGGAGTCG
GGGGGTTGAGGAGGAGGAGGAGGCGGAGGAGGAGGGTGTGTCTGGGCACGGAGCTGCCTTGCTGCCCGGGAACGT
CATGGTTGTTTATGGGGGAGGAAGATTGGTCATGATGTTCGGGGGGGGGAGGAGATGGGGTTGCGGTTCCTTAAC
CTGTCTTCCATGGAGTGGCTTTCTTCCTATCGCTACGACCGGGCCCGGATGGAGGTGGAACCAGCGGCGCCGGAG
CTGAGCGGAAGCGGACCTTCGGTTCGGCGACTGGGACTCGGTCTCGGTCTCGGTCTCGGCCTGGCACTTATACTG
GCCTTTCTCATCGCCCTCTGCGCCTGGATCCAGCGTCGTCGTCGTCGTCGTCGTCGTCGTCACCGTCGCCAGCTC
GGAGGTCATCTCGACGCCCAAGCCCACGGCATCGAAACCGACGCCTTCTCCTGGCGACGAAAGCAAGCCTACGGC
GCCGTCCCCGCCCGCAAGCCCCTCCCATCCGAGGCACGTTTCGACGCCTTCATCTCTCCTCCCGGCGTGATCCAT
CCTATCCTCGAGGAGGTTCCGGGGTCGGATGACGAGGGGGGGAAGGGACCGGGAGGAGGAGGAGCGGGAAGAGGA
CCAAGTGGAGCGGGAGCGGGAGGATCCGTTTGCTTCGCCGGGGAGGAGGTTGGATCCCGAGGTCAGGGAGTGGGT
CGATGGGGATGGGCTCTTGATGGCCAGGGTCGGGACGCAGGGGGGGTTGTTGATGTTGCCGCGGGAGTCTTCGCC
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail