Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06349
Gene name
Locationscaffold_07:2075466..2077160
Strand+
Gene length (bp)1694
Transcript length (bp)1482
Coding sequence length (bp)1482
Protein length (aa) 494

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03619 Solute_trans_a Organic solute transporter Ostalpha 8.4E-85 34 311

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1231 0.0785 0.0518 0.6492 0.0758 0.021 0.4738 0.62 0.4598 0.0076

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 31 53 22
2 66 88 22
3 103 122 19
4 165 187 22
5 207 229 22
6 249 271 22
7 284 306 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup392
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1240
Ophiocordyceps australis map64 (Brazil) OphauB2|604
Ophiocordyceps camponoti-floridani Ophcf2|06349 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5253
Ophiocordyceps kimflemingae Ophio5|1680
Ophiocordyceps subramaniannii Hirsu2|1738
Ophiocordyceps subramaniannii Hirsu2|6088
Ophiocordyceps subramaniannii Hirsu2|6705
Ophiocordyceps subramaniannii Hirsu2|6877

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06349
MNLTCNSTLEDMRIGLDDEMLLVGTLDFHDLARLIAAACTVVAVVMSLYLVWMHALHYTQPREQRYIIRILFMVP
VYAISSFLQLQWYWHAIYFQVISDCYEAFAIASFFALICHYVAPDLHSQKEYFRLMRPIKPWVWPVNWLAHCCGG
ERGPWRTPSSGLTYLNVVWIGVYHYCFIRVAMTVSAVVSQYFHRYCESSNSPVFGHIWIITLNAAAVTVAMFCLI
QFYVQLREPLAEHKLLTKMVAIKLVVFLSFWQVAAISVGTSTLNIVHPGQYIAYPDLKVGIPALLLCIEMAFFAI
FHLWAFPYKPYLDDAPVTVFPNPRPDGMSTPNERSPPSGGPFGLLALVDALNLWDFVKAFCRGVRWLLCGVKHRK
EDVSYRLDDERDHGHDLASLQAGKEPTLTHEAQSQSQSRSQPQSQSQSQSQSHYQPQKPWSPPPPYPPRTSSSSP
LPSPLPPHAVSTDESAGLMDNAHGLSRRDEAQVRVGEALWGKR*
Coding >Ophcf2|06349
ATGAACTTGACGTGCAACTCGACGCTCGAGGACATGAGGATCGGGCTTGATGACGAGATGCTTCTTGTTGGGACG
CTCGATTTTCATGACCTCGCGCGCTTGATTGCTGCGGCTTGTACCGTGGTTGCTGTTGTCATGAGCCTTTATCTT
GTTTGGATGCATGCGCTGCACTATACCCAGCCACGCGAGCAGCGATACATCATCCGCATCCTCTTCATGGTCCCC
GTCTACGCCATCTCGTCGTTCCTCCAACTGCAGTGGTACTGGCACGCCATCTACTTCCAGGTCATCTCCGACTGC
TACGAAGCTTTTGCCATCGCCTCCTTCTTCGCCCTCATCTGTCATTACGTCGCGCCCGATCTACACTCGCAGAAG
GAGTACTTTCGTCTCATGCGGCCCATCAAGCCTTGGGTTTGGCCCGTCAATTGGCTCGCTCATTGCTGTGGAGGC
GAGAGGGGACCATGGCGTACGCCTTCGTCGGGTTTGACGTACCTCAATGTCGTTTGGATTGGCGTCTATCACTAT
TGCTTTATCCGTGTTGCCATGACCGTCTCGGCTGTCGTATCGCAGTACTTTCACCGCTACTGCGAGAGCTCCAAC
AGTCCCGTCTTTGGCCATATCTGGATCATCACGCTCAACGCTGCCGCCGTCACCGTCGCCATGTTCTGCCTCATC
CAGTTCTACGTTCAGCTTCGTGAGCCCCTGGCCGAGCACAAGCTGCTCACCAAGATGGTTGCCATCAAACTCGTC
GTCTTCCTCTCCTTCTGGCAGGTCGCCGCCATCTCCGTCGGCACTTCGACCCTCAACATCGTCCATCCGGGCCAG
TATATTGCCTACCCGGACCTCAAGGTCGGCATCCCCGCCCTACTGCTGTGCATCGAGATGGCCTTCTTCGCCATC
TTCCACCTCTGGGCGTTTCCCTACAAGCCTTACCTCGACGACGCGCCCGTGACCGTCTTTCCGAATCCGCGCCCG
GACGGCATGTCGACGCCCAATGAGAGATCTCCGCCTTCGGGAGGGCCGTTTGGCCTGCTGGCTCTCGTCGACGCC
TTGAACCTGTGGGACTTTGTCAAGGCCTTTTGCCGGGGTGTGCGCTGGCTGCTCTGCGGCGTCAAGCATCGCAAG
GAAGATGTGAGCTACAGACTCGACGACGAGCGCGACCACGGCCACGACCTAGCCAGCCTGCAAGCAGGCAAGGAA
CCGACACTCACGCACGAAGCCCAATCTCAGTCTCAGTCTCGGTCTCAGCCTCAGTCTCAATCTCAATCTCAATCT
CAATCTCACTACCAGCCGCAGAAGCCGTGGTCGCCGCCACCGCCGTACCCACCTCGGACCAGCTCGTCGTCGCCT
TTACCTTCGCCCCTCCCGCCTCACGCGGTGAGCACGGATGAGAGCGCGGGGTTGATGGATAACGCGCACGGGCTG
TCGCGGCGGGATGAGGCGCAGGTAAGGGTTGGGGAGGCGCTGTGGGGGAAGAGGTAG
Transcript >Ophcf2|06349
ATGAACTTGACGTGCAACTCGACGCTCGAGGACATGAGGATCGGGCTTGATGACGAGATGCTTCTTGTTGGGACG
CTCGATTTTCATGACCTCGCGCGCTTGATTGCTGCGGCTTGTACCGTGGTTGCTGTTGTCATGAGCCTTTATCTT
GTTTGGATGCATGCGCTGCACTATACCCAGCCACGCGAGCAGCGATACATCATCCGCATCCTCTTCATGGTCCCC
GTCTACGCCATCTCGTCGTTCCTCCAACTGCAGTGGTACTGGCACGCCATCTACTTCCAGGTCATCTCCGACTGC
TACGAAGCTTTTGCCATCGCCTCCTTCTTCGCCCTCATCTGTCATTACGTCGCGCCCGATCTACACTCGCAGAAG
GAGTACTTTCGTCTCATGCGGCCCATCAAGCCTTGGGTTTGGCCCGTCAATTGGCTCGCTCATTGCTGTGGAGGC
GAGAGGGGACCATGGCGTACGCCTTCGTCGGGTTTGACGTACCTCAATGTCGTTTGGATTGGCGTCTATCACTAT
TGCTTTATCCGTGTTGCCATGACCGTCTCGGCTGTCGTATCGCAGTACTTTCACCGCTACTGCGAGAGCTCCAAC
AGTCCCGTCTTTGGCCATATCTGGATCATCACGCTCAACGCTGCCGCCGTCACCGTCGCCATGTTCTGCCTCATC
CAGTTCTACGTTCAGCTTCGTGAGCCCCTGGCCGAGCACAAGCTGCTCACCAAGATGGTTGCCATCAAACTCGTC
GTCTTCCTCTCCTTCTGGCAGGTCGCCGCCATCTCCGTCGGCACTTCGACCCTCAACATCGTCCATCCGGGCCAG
TATATTGCCTACCCGGACCTCAAGGTCGGCATCCCCGCCCTACTGCTGTGCATCGAGATGGCCTTCTTCGCCATC
TTCCACCTCTGGGCGTTTCCCTACAAGCCTTACCTCGACGACGCGCCCGTGACCGTCTTTCCGAATCCGCGCCCG
GACGGCATGTCGACGCCCAATGAGAGATCTCCGCCTTCGGGAGGGCCGTTTGGCCTGCTGGCTCTCGTCGACGCC
TTGAACCTGTGGGACTTTGTCAAGGCCTTTTGCCGGGGTGTGCGCTGGCTGCTCTGCGGCGTCAAGCATCGCAAG
GAAGATGTGAGCTACAGACTCGACGACGAGCGCGACCACGGCCACGACCTAGCCAGCCTGCAAGCAGGCAAGGAA
CCGACACTCACGCACGAAGCCCAATCTCAGTCTCAGTCTCGGTCTCAGCCTCAGTCTCAATCTCAATCTCAATCT
CAATCTCACTACCAGCCGCAGAAGCCGTGGTCGCCGCCACCGCCGTACCCACCTCGGACCAGCTCGTCGTCGCCT
TTACCTTCGCCCCTCCCGCCTCACGCGGTGAGCACGGATGAGAGCGCGGGGTTGATGGATAACGCGCACGGGCTG
TCGCGGCGGGATGAGGCGCAGGTAAGGGTTGGGGAGGCGCTGTGGGGGAAGAGGTAG
Gene >Ophcf2|06349
ATGAACTTGACGTGCAACTCGACGCTCGAGGACATGAGGAGTCGGTTTTCTCTCCCTCTTGTGGCCTTGACGAAG
CTGGGGACGTGGGCTAACGGTTTTCTTTTGGGGGGGCTTTTTTTTTGTGGGCGCAGTCGGGCTTGATGACGAGAT
GCTTCTTGTTGGGACGCTCGATTTTCATGACCTCGCGCGCTTGATTGCTGCGGCTTGTACCGTGGTTGCTGTTGT
CATGAGCCTTTATCTTGTTTGGATGCATGCGCTGCACTATACCCAGCCACGCGAGCAGCGATAGTAAGACTCTCT
CTTGCGTCGTTCCGTCCTCTCTTCTAACAGAAGCAGCATCATCCGCATCCTCTTCATGGTCCCCGTCTACGCCAT
CTCGTCGTTCCTCCAACTGCAGTGGTACTGGCACGCCATCTACTTCCAGGTCATCTCCGACTGCTACGAAGCTTT
TGCCATCGCCTCCTTCTTCGCCCTCATCTGTCATTACGTCGCGCCCGATCTACACTCGCAGAAGGAGTACTTTCG
TCTCATGCGGCCCATCAAGCCTTGGGTTTGGCCCGTCAATTGGCTCGCTCATTGCTGTGGAGGCGAGAGGGGACC
ATGGCGTACGCCTTCGTCGGGTTTGACGTACCTCAATGTCGTTTGGATTGGCGTCTATCACTATTGCTTTATCCG
TGTTGCCATGACCGTCTCGGCTGTCGTATCGCAGTACTTTCACCGCTACTGCGAGAGCTCCAACAGTCCCGTCTT
TGGCCATATCTGGGTGAGCTTCTCCGTTTTTTTCTATTCCTTTTTTCACATCCTTATCTATACTCTAATCCCCCC
GGGTTGTCCAGATCATCACGCTCAACGCTGCCGCCGTCACCGTCGCCATGTTCTGCCTCATCCAGTTCTACGTTC
AGCTTCGTGAGCCCCTGGCCGAGCACAAGCTGCTCACCAAGATGGTTGCCATCAAACTCGTCGTCTTCCTCTCCT
TCTGGCAGGTCGCCGCCATCTCCGTCGGCACTTCGACCCTCAACATCGTCCATCCGGGCCAGTATATTGCCTACC
CGGACCTCAAGGTCGGCATCCCCGCCCTACTGCTGTGCATCGAGATGGCCTTCTTCGCCATCTTCCACCTCTGGG
CGTTTCCCTACAAGCCTTACCTCGACGACGCGCCCGTGACCGTCTTTCCGAATCCGCGCCCGGACGGCATGTCGA
CGCCCAATGAGAGATCTCCGCCTTCGGGAGGGCCGTTTGGCCTGCTGGCTCTCGTCGACGCCTTGAACCTGTGGG
ACTTTGTCAAGGCCTTTTGCCGGGGTGTGCGCTGGCTGCTCTGCGGCGTCAAGCATCGCAAGGAAGATGTGAGCT
ACAGACTCGACGACGAGCGCGACCACGGCCACGACCTAGCCAGCCTGCAAGCAGGCAAGGAACCGACACTCACGC
ACGAAGCCCAATCTCAGTCTCAGTCTCGGTCTCAGCCTCAGTCTCAATCTCAATCTCAATCTCAATCTCACTACC
AGCCGCAGAAGCCGTGGTCGCCGCCACCGCCGTACCCACCTCGGACCAGCTCGTCGTCGCCTTTACCTTCGCCCC
TCCCGCCTCACGCGGTGAGCACGGATGAGAGCGCGGGGTTGATGGATAACGCGCACGGGCTGTCGCGGCGGGATG
AGGCGCAGGTAAGGGTTGGGGAGGCGCTGTGGGGGAAGAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail