Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06346
Gene name
Locationscaffold_07:2011410..2013857
Strand-
Gene length (bp)2447
Transcript length (bp)2187
Coding sequence length (bp)2187
Protein length (aa) 729

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.2E-41 52 541
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-19 107 483

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.5

Transmembrane Domains

Domain # Start End Length
1 59 81 22
2 101 123 22
3 136 158 22
4 194 216 22
5 245 267 22
6 341 363 22
7 376 398 22
8 408 426 18
9 433 455 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 1.19 0.16 2.22
Alive In ants, during behavior modification 21.03 10.61 31.45
Dead In ants, recently dead 16.89 8.68 25.10

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.266784 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06346
MGTPIRTYGGNRAFHNFYNDYSHIPDPNLRRRLALSEIDKVPLGLYHVRAIMVAGVGFLLDSYDIFAINLVTVLL
GMVFWGGARREDGYGGNGGLLPDETNQALKGATSAGIIVGMVVFGWLADTMGRRRMYGIDLAIIILATFSCALAS
ASPAMGPSALLIAWRVLMGIGIGGDYPLSSVITSEFAPTRWRGAMIAAVFSMQGVGLLMSALVALVTTVAFKASF
IDIVDETHCDANCQAAADRCWRIIVGVGAVPACLAMYYRITIPETPRYTFDVQHDVEKADADIRAYVQSKTQRAA
GKRFSATLLTVPRASWADLAAYFSHWAHLRVLIGTTMSWFFLDLAFYGLGLNSTVVLGAIGYGKGRNLYEKLYNQ
AVGIIILACAGSLPGYLSAVLTIDTVGRKPLQVTGFLLLTVIFCILGFNISRLSEGAMLALYVIGQFLFSAGPNT
TTFVVPGECFPTRYRATGHGLSAAMGKMGAVVAQVMSIPLLKPGSDDACTVGEQCAARLDRLMQLFALFMLLGTL
SSLLIPETKGLTLEELAGEASTSYNAGCNGSINHETTTPSSRWNPFRGGHPAGFYYPRSHAATLFGKSRRRSPRT
DIMVPFQPETPDTGFASPSSTASRGRRRRQHQQHHHHHHHHHHHLRRLIWRRESRNPRRDGSVESNEMTLRGGCT
PRSDPDHDAGRKPDEVPEWGAGWGRIDRGGPSPAGSSMQLQDVGMLLGGESRY*
Coding >Ophcf2|06346
ATGGGCACCCCAATCCGCACCTACGGCGGAAACCGAGCCTTTCACAACTTCTACAACGACTACTCGCATATCCCC
GACCCCAACCTCCGCCGCCGTCTCGCCCTCTCAGAGATCGACAAGGTCCCCCTCGGACTCTACCATGTGCGAGCC
ATCATGGTGGCGGGCGTCGGCTTCCTGCTCGACTCATACGACATCTTCGCCATTAACCTCGTCACCGTCCTGCTG
GGCATGGTCTTTTGGGGCGGAGCTCGACGAGAGGATGGCTATGGTGGGAACGGGGGCCTTCTACCGGATGAAACG
AATCAGGCGCTCAAGGGGGCTACGAGCGCGGGAATCATCGTCGGTATGGTGGTGTTTGGTTGGCTGGCAGACACC
ATGGGCCGTCGAAGGATGTACGGAATCGACCTCGCCATCATCATCCTAGCTACCTTTAGCTGCGCCCTCGCGTCG
GCCAGTCCAGCCATGGGTCCTTCGGCACTACTCATCGCATGGCGCGTACTGATGGGCATCGGCATAGGAGGAGAC
TATCCCCTCTCTTCAGTCATAACATCCGAATTCGCCCCAACCCGCTGGCGAGGCGCAATGATCGCCGCCGTCTTC
TCCATGCAAGGCGTGGGCCTCCTCATGTCCGCCCTCGTCGCCCTCGTCACCACCGTCGCCTTCAAGGCCTCCTTC
ATCGACATCGTCGACGAAACGCACTGCGACGCAAACTGTCAGGCTGCCGCCGACCGCTGCTGGCGTATCATCGTC
GGCGTAGGTGCCGTACCAGCCTGTCTGGCCATGTACTACCGCATCACCATCCCCGAGACTCCACGGTATACCTTT
GACGTCCAGCATGATGTCGAAAAGGCCGATGCCGATATCCGAGCCTATGTCCAGAGCAAGACGCAGAGAGCGGCT
GGGAAGAGATTCTCCGCCACGCTGCTGACGGTTCCGAGGGCGTCTTGGGCCGATCTGGCTGCCTACTTCAGTCAT
TGGGCTCACCTACGCGTACTGATAGGCACCACCATGTCGTGGTTCTTTCTCGACCTCGCCTTCTACGGCCTCGGA
CTCAATAGCACCGTCGTCCTCGGCGCCATCGGCTACGGCAAAGGCCGCAACTTGTACGAGAAGCTATACAACCAA
GCCGTCGGCATCATCATCCTCGCCTGCGCCGGCTCCCTCCCCGGCTACCTCTCCGCCGTACTGACCATCGACACC
GTCGGCCGCAAGCCGCTACAGGTAACGGGCTTCCTCCTCCTCACCGTCATCTTCTGCATCCTCGGCTTCAACATC
AGCCGGCTGAGCGAAGGCGCCATGCTGGCCCTCTACGTCATCGGACAGTTCCTCTTCAGCGCGGGACCCAACACC
ACCACCTTTGTCGTGCCCGGAGAATGCTTCCCAACCCGGTACCGAGCCACGGGCCACGGCCTATCGGCAGCGATG
GGCAAGATGGGCGCCGTCGTAGCCCAGGTCATGAGCATCCCGCTGCTCAAGCCGGGTTCCGATGACGCCTGCACC
GTCGGAGAGCAGTGTGCAGCCAGGCTGGACCGTCTGATGCAGCTATTCGCCCTCTTCATGCTGCTGGGCACCCTG
TCATCGCTCCTGATCCCCGAGACGAAAGGCCTGACGCTCGAGGAGCTAGCCGGTGAGGCTAGCACGAGCTACAAC
GCCGGCTGTAACGGGAGCATCAACCACGAGACAACGACTCCCTCCTCTCGCTGGAATCCCTTCCGGGGCGGCCAC
CCAGCAGGTTTCTACTACCCACGCTCCCACGCCGCGACTCTCTTCGGAAAAAGCCGCCGCCGATCACCACGAACA
GACATCATGGTCCCGTTCCAGCCGGAAACCCCAGACACAGGCTTTGCCTCCCCGTCATCGACCGCCAGTAGAGGC
CGCAGACGACGACAGCACCAGCAGCATCACCACCACCATCACCACCACCACCACCACCTACGACGTCTCATCTGG
CGTCGCGAAAGCCGCAATCCTCGCCGCGACGGAAGCGTCGAGTCGAATGAGATGACGCTTCGGGGGGGCTGCACG
CCGAGATCGGATCCGGATCATGACGCGGGACGGAAGCCGGATGAGGTGCCGGAGTGGGGCGCCGGATGGGGCCGG
ATCGACCGGGGTGGACCGTCTCCGGCGGGGAGTAGCATGCAGCTACAGGACGTGGGGATGCTGCTGGGAGGAGAG
TCTAGGTATTGA
Transcript >Ophcf2|06346
ATGGGCACCCCAATCCGCACCTACGGCGGAAACCGAGCCTTTCACAACTTCTACAACGACTACTCGCATATCCCC
GACCCCAACCTCCGCCGCCGTCTCGCCCTCTCAGAGATCGACAAGGTCCCCCTCGGACTCTACCATGTGCGAGCC
ATCATGGTGGCGGGCGTCGGCTTCCTGCTCGACTCATACGACATCTTCGCCATTAACCTCGTCACCGTCCTGCTG
GGCATGGTCTTTTGGGGCGGAGCTCGACGAGAGGATGGCTATGGTGGGAACGGGGGCCTTCTACCGGATGAAACG
AATCAGGCGCTCAAGGGGGCTACGAGCGCGGGAATCATCGTCGGTATGGTGGTGTTTGGTTGGCTGGCAGACACC
ATGGGCCGTCGAAGGATGTACGGAATCGACCTCGCCATCATCATCCTAGCTACCTTTAGCTGCGCCCTCGCGTCG
GCCAGTCCAGCCATGGGTCCTTCGGCACTACTCATCGCATGGCGCGTACTGATGGGCATCGGCATAGGAGGAGAC
TATCCCCTCTCTTCAGTCATAACATCCGAATTCGCCCCAACCCGCTGGCGAGGCGCAATGATCGCCGCCGTCTTC
TCCATGCAAGGCGTGGGCCTCCTCATGTCCGCCCTCGTCGCCCTCGTCACCACCGTCGCCTTCAAGGCCTCCTTC
ATCGACATCGTCGACGAAACGCACTGCGACGCAAACTGTCAGGCTGCCGCCGACCGCTGCTGGCGTATCATCGTC
GGCGTAGGTGCCGTACCAGCCTGTCTGGCCATGTACTACCGCATCACCATCCCCGAGACTCCACGGTATACCTTT
GACGTCCAGCATGATGTCGAAAAGGCCGATGCCGATATCCGAGCCTATGTCCAGAGCAAGACGCAGAGAGCGGCT
GGGAAGAGATTCTCCGCCACGCTGCTGACGGTTCCGAGGGCGTCTTGGGCCGATCTGGCTGCCTACTTCAGTCAT
TGGGCTCACCTACGCGTACTGATAGGCACCACCATGTCGTGGTTCTTTCTCGACCTCGCCTTCTACGGCCTCGGA
CTCAATAGCACCGTCGTCCTCGGCGCCATCGGCTACGGCAAAGGCCGCAACTTGTACGAGAAGCTATACAACCAA
GCCGTCGGCATCATCATCCTCGCCTGCGCCGGCTCCCTCCCCGGCTACCTCTCCGCCGTACTGACCATCGACACC
GTCGGCCGCAAGCCGCTACAGGTAACGGGCTTCCTCCTCCTCACCGTCATCTTCTGCATCCTCGGCTTCAACATC
AGCCGGCTGAGCGAAGGCGCCATGCTGGCCCTCTACGTCATCGGACAGTTCCTCTTCAGCGCGGGACCCAACACC
ACCACCTTTGTCGTGCCCGGAGAATGCTTCCCAACCCGGTACCGAGCCACGGGCCACGGCCTATCGGCAGCGATG
GGCAAGATGGGCGCCGTCGTAGCCCAGGTCATGAGCATCCCGCTGCTCAAGCCGGGTTCCGATGACGCCTGCACC
GTCGGAGAGCAGTGTGCAGCCAGGCTGGACCGTCTGATGCAGCTATTCGCCCTCTTCATGCTGCTGGGCACCCTG
TCATCGCTCCTGATCCCCGAGACGAAAGGCCTGACGCTCGAGGAGCTAGCCGGTGAGGCTAGCACGAGCTACAAC
GCCGGCTGTAACGGGAGCATCAACCACGAGACAACGACTCCCTCCTCTCGCTGGAATCCCTTCCGGGGCGGCCAC
CCAGCAGGTTTCTACTACCCACGCTCCCACGCCGCGACTCTCTTCGGAAAAAGCCGCCGCCGATCACCACGAACA
GACATCATGGTCCCGTTCCAGCCGGAAACCCCAGACACAGGCTTTGCCTCCCCGTCATCGACCGCCAGTAGAGGC
CGCAGACGACGACAGCACCAGCAGCATCACCACCACCATCACCACCACCACCACCACCTACGACGTCTCATCTGG
CGTCGCGAAAGCCGCAATCCTCGCCGCGACGGAAGCGTCGAGTCGAATGAGATGACGCTTCGGGGGGGCTGCACG
CCGAGATCGGATCCGGATCATGACGCGGGACGGAAGCCGGATGAGGTGCCGGAGTGGGGCGCCGGATGGGGCCGG
ATCGACCGGGGTGGACCGTCTCCGGCGGGGAGTAGCATGCAGCTACAGGACGTGGGGATGCTGCTGGGAGGAGAG
TCTAGGTATTGA
Gene >Ophcf2|06346
ATGGGCACCCCAATCCGCACCTACGGCGGAAACCGAGCCTTTCACAACTTCTACAACGACTACTCGCATATCCCC
GACCCCAACCTCCGCCGCCGTCTCGCCCTCTCAGAGATCGACAAGGTCCCCCTCGGACTCTACCGTGAGACTCGC
CGCCCCAGATGACAAGACGACGCGAACCCTAGAGCTGACGAGCGGCAGATGTGCGAGCCATCATGGTGGCGGGCG
TCGGCTTCCTGCTCGACTCATACGACATCTTCGCCATTAACCTCGTCACCGTCCTGCTGGGCATGGTCTTTTGGG
GCGGAGCTCGACGAGAGGATGGCTATGGTGGGAACGGGGGCCTTCTACCGGATGAAACGAATCAGGCGCTCAAGG
GGGCTACGAGCGCGGGAATCATCGTCGGTATGGTGGTGTTTGGTTGGCTGGCAGAGTGAGTGGCCTCTTGGATAG
ATGATCAAGATCAAAGCTAGAGATGGCTTCGCTAACGGTATCAAGCACCATGGGCCGTCGAAGGATGTACGGAAT
CGACCTCGCCATCATCATCCTAGCTACCTTTAGCTGCGCCCTCGCGTCGGCCAGTCCAGCCATGGGTCCTTCGGC
ACTACTCATCGCATGGCGCGTACTGATGGGCATCGGCATAGGAGGAGACTATCCCCTCTCTTCAGTCATAACATC
CGAGTAAGCATCCCCATACCCCCCCCCCCCCTTCACGATGAGCACCGACGACTAAACCTGGCCGAGATTCGCCCC
AACCCGCTGGCGAGGCGCAATGATCGCCGCCGTCTTCTCCATGCAAGGCGTGGGCCTCCTCATGTCCGCCCTCGT
CGCCCTCGTCACCACCGTCGCCTTCAAGGCCTCCTTCATCGACATCGTCGACGAAACGCACTGCGACGCAAACTG
TCAGGCTGCCGCCGACCGCTGCTGGCGTATCATCGTCGGCGTAGGTGCCGTACCAGCCTGTCTGGCCATGTACTA
CCGCATCACCATCCCCGAGACTCCACGGTATACCTTTGACGTCCAGCATGATGTCGAAAAGGCCGATGCCGATAT
CCGAGCCTATGTCCAGAGCAAGACGCAGAGAGCGGCTGGGAAGAGATTCTCCGCCACGCTGCTGACGGTTCCGAG
GGCGTCTTGGGCCGATCTGGCTGCCTACTTCAGTCATTGGGCTCACCTACGCGTACTGATAGGCACCACCATGTC
GTGGTTCTTTCTCGTCCGTCTCTCTTCTCTCTCCCCGTCCCCGGTCTCCCGTTCTCTCCTCTCTTCGCTGACTCG
AGATGATCAAGGACCTCGCCTTCTACGGCCTCGGACTCAATAGCACCGTCGTCCTCGGCGCCATCGGCTACGGCA
AAGGCCGCAACTTGTACGAGAAGCTATACAACCAAGCCGTCGGCATCATCATCCTCGCCTGCGCCGGCTCCCTCC
CCGGCTACCTCTCCGCCGTACTGACCATCGACACCGTCGGCCGCAAGCCGCTACAGGTAACGGGCTTCCTCCTCC
TCACCGTCATCTTCTGCATCCTCGGCTTCAACATCAGCCGGCTGAGCGAAGGCGCCATGCTGGCCCTCTACGTCA
TCGGACAGTTCCTCTTCAGCGCGGGACCCAACACCACCACCTTTGTCGTGCCCGGAGAATGCTTCCCAACCCGGT
ACCGAGCCACGGGCCACGGCCTATCGGCAGCGATGGGCAAGATGGGCGCCGTCGTAGCCCAGGTCATGAGCATCC
CGCTGCTCAAGCCGGGTTCCGATGACGCCTGCACCGTCGGAGAGCAGTGTGCAGCCAGGCTGGACCGTCTGATGC
AGCTATTCGCCCTCTTCATGCTGCTGGGCACCCTGTCATCGCTCCTGATCCCCGAGACGAAAGGCCTGACGCTCG
AGGAGCTAGCCGGTGAGGCTAGCACGAGCTACAACGCCGGCTGTAACGGGAGCATCAACCACGAGACAACGACTC
CCTCCTCTCGCTGGAATCCCTTCCGGGGCGGCCACCCAGCAGGTTTCTACTACCCACGCTCCCACGCCGCGACTC
TCTTCGGAAAAAGCCGCCGCCGATCACCACGAACAGACATCATGGTCCCGTTCCAGCCGGAAACCCCAGACACAG
GCTTTGCCTCCCCGTCATCGACCGCCAGTAGAGGCCGCAGACGACGACAGCACCAGCAGCATCACCACCACCATC
ACCACCACCACCACCACCTACGACGTCTCATCTGGCGTCGCGAAAGCCGCAATCCTCGCCGCGACGGAAGCGTCG
AGTCGAATGAGATGACGCTTCGGGGGGGCTGCACGCCGAGATCGGATCCGGATCATGACGCGGGACGGAAGCCGG
ATGAGGTGCCGGAGTGGGGCGCCGGATGGGGCCGGATCGACCGGGGTGGACCGTCTCCGGCGGGGAGTAGCATGC
AGCTACAGGACGTGGGGATGCTGCTGGGAGGAGAGTCTAGGTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail