Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06345
Gene name
Locationscaffold_07:2010688..2011079
Strand+
Gene length (bp)391
Transcript length (bp)216
Coding sequence length (bp)216
Protein length (aa) 72

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0853 0.0697 0.9636 0.0479 0.0641 0.0158 0.0895 0.0898 0.0695 0.0059

SignalP

SignalP signal predicted Location Score
Yes 1 - 25 0.999736

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup7429
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06345 (this protein)
Ophiocordyceps kimflemingae Ophio5|1675

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06345
MNKLFLVIISLVCAAAALPAQQANAIDASRSFTCPSRVLAFCRARNVHSGCTFNGSFRSDAMETCRECHCG*
Coding >Ophcf2|06345
ATGAACAAGCTCTTCCTCGTCATCATCTCCCTGGTGTGCGCCGCCGCCGCTCTCCCCGCGCAGCAGGCCAACGCC
ATCGACGCCAGCCGATCCTTTACCTGTCCGTCGCGCGTGCTGGCGTTTTGCCGCGCGAGGAACGTCCATTCCGGC
TGTACCTTTAACGGTAGCTTCCGGTCTGATGCTATGGAGACCTGTAGGGAGTGTCACTGTGGGTGA
Transcript >Ophcf2|06345
ATGAACAAGCTCTTCCTCGTCATCATCTCCCTGGTGTGCGCCGCCGCCGCTCTCCCCGCGCAGCAGGCCAACGCC
ATCGACGCCAGCCGATCCTTTACCTGTCCGTCGCGCGTGCTGGCGTTTTGCCGCGCGAGGAACGTCCATTCCGGC
TGTACCTTTAACGGTAGCTTCCGGTCTGATGCTATGGAGACCTGTAGGGAGTGTCACTGTGGGTGA
Gene >Ophcf2|06345
ATGAACAAGGTGCGTTCCCTTTCCCCCCTTCCCTCTCCCCCCTTCCCTCCCCGGTTCCCATAACCGGAGCTCAAT
TCAGCCACTGACGAAGCACAGCTCTTCCTCGTCATCATCTCCCTGGTGTGCGCCGCCGCCGCTCTCCCCGCGCAG
CAGGCCAACGCCATCGACGCCAGCCGATCCTTTACCTGTCCGTCGCGCGTGCTGGCGTTTTGCCGCGCGAGGAAC
GTCCATTCCGGCTGTACCTTTAACGGTAGCTTCCGGTCTGATGCTATGGAGACCTGTAGGGAGTGTCACTGTGGT
GAGTTTTTTTTTTTTTTTTTCCCCCGGCTTTCTTCTTGTTGTCTCCCATTGGGCCTCGGAGGATGCTGACGTCTC
GGTGAGTTTAGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail