Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06341
Gene name
Locationscaffold_07:2002551..2004173
Strand-
Gene length (bp)1622
Transcript length (bp)1566
Coding sequence length (bp)1566
Protein length (aa) 522

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00569 ZZ Zinc finger, ZZ type 1.5E-08 18 59
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 9.6E-07 80 124

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3201 0.915 0.0271 0.0172 0.0226 0.004 0.0473 0.033 0.0244 0.006

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4228
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|687
Ophiocordyceps australis map64 (Brazil) OphauB2|5642
Ophiocordyceps camponoti-floridani Ophcf2|06341 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3519
Ophiocordyceps kimflemingae Ophio5|1670
Ophiocordyceps subramaniannii Hirsu2|8628

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06341
MGVIRKKTATRGGEGGVKYVCDVCSSDITSTVRIRCADPACSDFDLCVSCFAKGESRNAHDPATHPYRVIEQNSF
PIFEKEWGADEELLMLEGAEVYGLGSWADIADHIGGFRDKDEVRDHYLSTYVSSERFPLPARCSPYDSELATQVP
REEFQARKKRRIEERRDKAKNAPALQAKTKPTASVPSCHEIQGYMPGRLEFETEYANEAEEAVQNMQFDPGDGLN
SRTGDMEPEMELKLTVMEIYNCRLTQRVERKRVIFEHDLLDYRENTKTDKRRNKEEKELLQKAKPFARIMNHTDF
EDFNQGLVDELNLRQAIAQLQEWRSVRIGDLRSGEKYEAEKAQRAQKSIPMGSMDRERLASSQRSKQPPPPDAPS
GAALLVAPELPIRPGPPPSTTNPTTATAANGETKTNGQAANGTIDATQNDTTRQRHMPQPIPGVLPLSQDNAPDL
HLLTPEEAKLCEVVRLQPKPYLMIKDQLLREALKSNGTLKRKQAKEICRLDSQKGAKIFDFFINAGWLGKA*
Coding >Ophcf2|06341
ATGGGTGTCATCCGCAAGAAGACGGCGACGCGCGGCGGAGAAGGAGGCGTCAAATACGTTTGCGACGTTTGCTCG
TCGGATATCACGTCGACGGTCCGCATTAGGTGTGCAGACCCGGCGTGCTCCGACTTTGACCTCTGTGTCTCGTGC
TTCGCCAAGGGGGAGTCTCGAAACGCTCACGATCCTGCGACGCACCCGTATCGTGTCATCGAGCAGAATTCGTTT
CCCATATTCGAAAAGGAGTGGGGCGCCGATGAGGAGCTCCTGATGCTAGAGGGCGCCGAGGTCTACGGCCTGGGC
TCCTGGGCCGATATCGCCGATCACATAGGAGGCTTTCGAGATAAGGACGAGGTCCGCGATCACTACCTATCGACG
TACGTCTCCTCGGAGCGCTTCCCGCTGCCCGCGAGATGCAGCCCGTACGACTCGGAGCTGGCAACGCAGGTGCCG
CGCGAAGAGTTTCAGGCTCGCAAAAAGCGACGCATCGAAGAGCGGAGGGACAAGGCAAAGAATGCCCCGGCTCTG
CAGGCCAAGACGAAGCCGACGGCCAGCGTTCCGAGTTGCCACGAGATCCAGGGCTACATGCCGGGCCGGCTCGAG
TTCGAGACCGAGTACGCCAACGAGGCAGAGGAGGCGGTCCAGAATATGCAGTTTGATCCAGGCGACGGGCTCAAT
TCCCGCACGGGCGATATGGAGCCCGAGATGGAACTGAAGCTGACCGTCATGGAGATTTACAACTGCCGGCTGACG
CAGCGCGTGGAGCGCAAGAGGGTCATCTTCGAGCACGACCTGCTCGACTACCGTGAGAACACCAAGACGGACAAG
CGACGCAACAAGGAGGAAAAGGAACTGCTGCAAAAGGCAAAGCCCTTTGCGCGCATCATGAACCACACCGACTTT
GAAGACTTTAACCAGGGCCTCGTGGACGAGCTGAACCTGAGACAGGCCATTGCGCAGCTGCAGGAGTGGCGCAGC
GTGCGCATCGGCGACTTGCGCAGCGGGGAAAAGTACGAGGCAGAAAAGGCGCAGCGGGCGCAAAAGTCGATACCG
ATGGGGTCCATGGACCGCGAGCGTCTGGCATCGAGTCAGCGGTCTAAGCAGCCACCACCGCCCGATGCACCGAGC
GGCGCGGCGCTACTAGTGGCACCGGAGCTGCCGATCCGGCCGGGACCGCCGCCGTCGACGACTAACCCGACGACG
GCGACGGCAGCCAACGGCGAGACCAAGACCAACGGACAGGCGGCCAACGGCACAATCGACGCGACGCAAAACGAC
ACGACGAGGCAACGACACATGCCGCAACCGATACCGGGCGTGCTGCCGCTGAGCCAGGATAATGCGCCGGACCTG
CACCTGCTGACGCCGGAAGAGGCCAAGCTATGCGAGGTGGTGCGGCTGCAGCCGAAGCCTTACTTGATGATCAAG
GACCAGCTGCTCCGGGAGGCGCTCAAGTCCAACGGGACGCTCAAGAGGAAGCAGGCCAAGGAGATTTGCCGGCTG
GATTCGCAGAAGGGGGCCAAGATTTTCGACTTCTTCATCAATGCTGGGTGGCTAGGCAAGGCGTAG
Transcript >Ophcf2|06341
ATGGGTGTCATCCGCAAGAAGACGGCGACGCGCGGCGGAGAAGGAGGCGTCAAATACGTTTGCGACGTTTGCTCG
TCGGATATCACGTCGACGGTCCGCATTAGGTGTGCAGACCCGGCGTGCTCCGACTTTGACCTCTGTGTCTCGTGC
TTCGCCAAGGGGGAGTCTCGAAACGCTCACGATCCTGCGACGCACCCGTATCGTGTCATCGAGCAGAATTCGTTT
CCCATATTCGAAAAGGAGTGGGGCGCCGATGAGGAGCTCCTGATGCTAGAGGGCGCCGAGGTCTACGGCCTGGGC
TCCTGGGCCGATATCGCCGATCACATAGGAGGCTTTCGAGATAAGGACGAGGTCCGCGATCACTACCTATCGACG
TACGTCTCCTCGGAGCGCTTCCCGCTGCCCGCGAGATGCAGCCCGTACGACTCGGAGCTGGCAACGCAGGTGCCG
CGCGAAGAGTTTCAGGCTCGCAAAAAGCGACGCATCGAAGAGCGGAGGGACAAGGCAAAGAATGCCCCGGCTCTG
CAGGCCAAGACGAAGCCGACGGCCAGCGTTCCGAGTTGCCACGAGATCCAGGGCTACATGCCGGGCCGGCTCGAG
TTCGAGACCGAGTACGCCAACGAGGCAGAGGAGGCGGTCCAGAATATGCAGTTTGATCCAGGCGACGGGCTCAAT
TCCCGCACGGGCGATATGGAGCCCGAGATGGAACTGAAGCTGACCGTCATGGAGATTTACAACTGCCGGCTGACG
CAGCGCGTGGAGCGCAAGAGGGTCATCTTCGAGCACGACCTGCTCGACTACCGTGAGAACACCAAGACGGACAAG
CGACGCAACAAGGAGGAAAAGGAACTGCTGCAAAAGGCAAAGCCCTTTGCGCGCATCATGAACCACACCGACTTT
GAAGACTTTAACCAGGGCCTCGTGGACGAGCTGAACCTGAGACAGGCCATTGCGCAGCTGCAGGAGTGGCGCAGC
GTGCGCATCGGCGACTTGCGCAGCGGGGAAAAGTACGAGGCAGAAAAGGCGCAGCGGGCGCAAAAGTCGATACCG
ATGGGGTCCATGGACCGCGAGCGTCTGGCATCGAGTCAGCGGTCTAAGCAGCCACCACCGCCCGATGCACCGAGC
GGCGCGGCGCTACTAGTGGCACCGGAGCTGCCGATCCGGCCGGGACCGCCGCCGTCGACGACTAACCCGACGACG
GCGACGGCAGCCAACGGCGAGACCAAGACCAACGGACAGGCGGCCAACGGCACAATCGACGCGACGCAAAACGAC
ACGACGAGGCAACGACACATGCCGCAACCGATACCGGGCGTGCTGCCGCTGAGCCAGGATAATGCGCCGGACCTG
CACCTGCTGACGCCGGAAGAGGCCAAGCTATGCGAGGTGGTGCGGCTGCAGCCGAAGCCTTACTTGATGATCAAG
GACCAGCTGCTCCGGGAGGCGCTCAAGTCCAACGGGACGCTCAAGAGGAAGCAGGCCAAGGAGATTTGCCGGCTG
GATTCGCAGAAGGGGGCCAAGATTTTCGACTTCTTCATCAATGCTGGGTGGCTAGGCAAGGCGTAG
Gene >Ophcf2|06341
ATGGGTGTCATCCGCAAGAAGACGGCGACGCGCGGCGGAGAAGGAGGCGTCAAATACGTTTGCGACGTTTGCTCG
TCGGATATCACGTCGACGGTCCGCGCTGGTCGATTCTCTGTGCACACTTCCTCGGCTGACTCCCATGTTTCTAGG
TCCGCATTAGGTGTGCAGACCCGGCGTGCTCCGACTTTGACCTCTGTGTCTCGTGCTTCGCCAAGGGGGAGTCTC
GAAACGCTCACGATCCTGCGACGCACCCGTATCGTGTCATCGAGCAGAATTCGTTTCCCATATTCGAAAAGGAGT
GGGGCGCCGATGAGGAGCTCCTGATGCTAGAGGGCGCCGAGGTCTACGGCCTGGGCTCCTGGGCCGATATCGCCG
ATCACATAGGAGGCTTTCGAGATAAGGACGAGGTCCGCGATCACTACCTATCGACGTACGTCTCCTCGGAGCGCT
TCCCGCTGCCCGCGAGATGCAGCCCGTACGACTCGGAGCTGGCAACGCAGGTGCCGCGCGAAGAGTTTCAGGCTC
GCAAAAAGCGACGCATCGAAGAGCGGAGGGACAAGGCAAAGAATGCCCCGGCTCTGCAGGCCAAGACGAAGCCGA
CGGCCAGCGTTCCGAGTTGCCACGAGATCCAGGGCTACATGCCGGGCCGGCTCGAGTTCGAGACCGAGTACGCCA
ACGAGGCAGAGGAGGCGGTCCAGAATATGCAGTTTGATCCAGGCGACGGGCTCAATTCCCGCACGGGCGATATGG
AGCCCGAGATGGAACTGAAGCTGACCGTCATGGAGATTTACAACTGCCGGCTGACGCAGCGCGTGGAGCGCAAGA
GGGTCATCTTCGAGCACGACCTGCTCGACTACCGTGAGAACACCAAGACGGACAAGCGACGCAACAAGGAGGAAA
AGGAACTGCTGCAAAAGGCAAAGCCCTTTGCGCGCATCATGAACCACACCGACTTTGAAGACTTTAACCAGGGCC
TCGTGGACGAGCTGAACCTGAGACAGGCCATTGCGCAGCTGCAGGAGTGGCGCAGCGTGCGCATCGGCGACTTGC
GCAGCGGGGAAAAGTACGAGGCAGAAAAGGCGCAGCGGGCGCAAAAGTCGATACCGATGGGGTCCATGGACCGCG
AGCGTCTGGCATCGAGTCAGCGGTCTAAGCAGCCACCACCGCCCGATGCACCGAGCGGCGCGGCGCTACTAGTGG
CACCGGAGCTGCCGATCCGGCCGGGACCGCCGCCGTCGACGACTAACCCGACGACGGCGACGGCAGCCAACGGCG
AGACCAAGACCAACGGACAGGCGGCCAACGGCACAATCGACGCGACGCAAAACGACACGACGAGGCAACGACACA
TGCCGCAACCGATACCGGGCGTGCTGCCGCTGAGCCAGGATAATGCGCCGGACCTGCACCTGCTGACGCCGGAAG
AGGCCAAGCTATGCGAGGTGGTGCGGCTGCAGCCGAAGCCTTACTTGATGATCAAGGACCAGCTGCTCCGGGAGG
CGCTCAAGTCCAACGGGACGCTCAAGAGGAAGCAGGCCAAGGAGATTTGCCGGCTGGATTCGCAGAAGGGGGCCA
AGATTTTCGACTTCTTCATCAATGCTGGGTGGCTAGGCAAGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail