Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06339
Gene name
Locationscaffold_07:1999850..2001112
Strand-
Gene length (bp)1262
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01087 GalP_UDP_transf Galactose-1-phosphate uridyl transferase, N-terminal domain 6.4E-67 8 208
PF02744 GalP_UDP_tr_C Galactose-1-phosphate uridyl transferase, C-terminal domain 9.2E-57 215 371

GO

GO Term Description Terminal node
GO:0006012 galactose metabolic process Yes
GO:0008108 UDP-glucose:hexose-1-phosphate uridylyltransferase activity Yes
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0044281 small molecule metabolic process No
GO:0005996 monosaccharide metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0005975 carbohydrate metabolic process No
GO:0019318 hexose metabolic process No
GO:0070569 uridylyltransferase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus|Peroxisome Peroxisomal targeting signal 0.2766 0.5781 0.0598 0.0246 0.2224 0.0176 0.0814 0.1122 0.0751 0.9355

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4227
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|686
Ophiocordyceps australis map64 (Brazil) OphauB2|5643
Ophiocordyceps camponoti-floridani Ophcf2|06339 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3521
Ophiocordyceps kimflemingae Ophio5|1669
Ophiocordyceps subramaniannii Hirsu2|8626

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06339
MPDQILNDISHRRYNPLTDSWLLVSPHRTKRPWQGAQEAASTETLPEHDAKCYLCPGNARAAGDRNPDYEQTFAF
VNDYSAVREEQPAYETETDGQDVESLLLRAEAVTGVCYVLTFSPKHNLTLADMAATEMVPTIEHWTRLYANHLAA
SNPLSRLAGELELSIPRHGAPVPGAEYRYMQIFENKGAAMGCSNPHPHCQVWTTSTMPDEPGRELAQMAKYRARN
GGRHLLGDYVQLELTKGERVLWQNDAFVIVCPWWAVWPFEVLILPKRHVRSLVDLSSRERLALAEAMHEVTRRYD
NLFQCSFPYSSGIHQAPLKGTDDEVDNSYLHMHFYPPLLRSASVKKFLVGYELMAQPQRDITPEQAAARLRDCGG
ELYRVEKRR*
Coding >Ophcf2|06339
ATGCCAGACCAGATCCTCAACGACATTTCCCACAGGCGGTACAACCCGCTGACCGACAGCTGGCTCCTCGTCTCG
CCGCATCGCACCAAGCGTCCGTGGCAGGGCGCGCAGGAGGCTGCTTCGACGGAGACGCTGCCGGAGCACGATGCA
AAGTGCTATCTCTGTCCTGGGAATGCGCGGGCGGCTGGTGATAGAAATCCAGACTATGAGCAGACGTTTGCCTTT
GTCAACGATTACAGCGCCGTTCGAGAGGAGCAGCCTGCCTACGAAACTGAAACTGATGGGCAAGATGTTGAATCA
TTGCTTCTTCGCGCAGAGGCCGTTACGGGCGTCTGCTACGTGCTCACTTTCTCCCCCAAGCATAACCTGACGCTG
GCAGACATGGCAGCCACCGAGATGGTACCGACCATCGAGCACTGGACGCGTCTGTACGCCAACCATCTCGCGGCG
TCGAATCCTCTATCCCGGCTCGCGGGGGAGCTTGAGCTGTCGATTCCTCGGCATGGTGCGCCTGTTCCGGGGGCT
GAGTATCGGTACATGCAGATCTTTGAGAATAAGGGTGCTGCTATGGGATGCTCTAATCCGCATCCTCACTGTCAG
GTGTGGACGACGTCGACGATGCCTGATGAGCCGGGCCGGGAGTTGGCGCAGATGGCAAAGTATCGTGCTCGGAAT
GGGGGTCGTCACCTCCTAGGCGACTACGTGCAGCTAGAGCTCACCAAAGGCGAACGCGTGCTATGGCAAAACGAC
GCCTTTGTCATCGTCTGTCCCTGGTGGGCGGTGTGGCCATTCGAAGTCCTCATCCTACCAAAGCGTCACGTCCGA
TCCCTCGTCGATCTCTCATCCCGCGAGCGACTAGCCCTCGCCGAAGCCATGCACGAGGTGACGCGCCGATACGAC
AACCTATTCCAATGCAGCTTCCCTTACAGCTCTGGCATTCATCAGGCGCCGCTCAAGGGGACGGACGATGAGGTG
GACAACTCCTACCTGCACATGCACTTTTACCCGCCGCTTCTGCGCTCGGCTTCGGTCAAGAAGTTCTTGGTGGGA
TATGAGCTTATGGCGCAGCCGCAGCGGGATATCACGCCGGAGCAGGCGGCGGCTCGGTTGCGGGACTGCGGTGGC
GAGCTGTATCGTGTTGAGAAGAGACGGTAG
Transcript >Ophcf2|06339
ATGCCAGACCAGATCCTCAACGACATTTCCCACAGGCGGTACAACCCGCTGACCGACAGCTGGCTCCTCGTCTCG
CCGCATCGCACCAAGCGTCCGTGGCAGGGCGCGCAGGAGGCTGCTTCGACGGAGACGCTGCCGGAGCACGATGCA
AAGTGCTATCTCTGTCCTGGGAATGCGCGGGCGGCTGGTGATAGAAATCCAGACTATGAGCAGACGTTTGCCTTT
GTCAACGATTACAGCGCCGTTCGAGAGGAGCAGCCTGCCTACGAAACTGAAACTGATGGGCAAGATGTTGAATCA
TTGCTTCTTCGCGCAGAGGCCGTTACGGGCGTCTGCTACGTGCTCACTTTCTCCCCCAAGCATAACCTGACGCTG
GCAGACATGGCAGCCACCGAGATGGTACCGACCATCGAGCACTGGACGCGTCTGTACGCCAACCATCTCGCGGCG
TCGAATCCTCTATCCCGGCTCGCGGGGGAGCTTGAGCTGTCGATTCCTCGGCATGGTGCGCCTGTTCCGGGGGCT
GAGTATCGGTACATGCAGATCTTTGAGAATAAGGGTGCTGCTATGGGATGCTCTAATCCGCATCCTCACTGTCAG
GTGTGGACGACGTCGACGATGCCTGATGAGCCGGGCCGGGAGTTGGCGCAGATGGCAAAGTATCGTGCTCGGAAT
GGGGGTCGTCACCTCCTAGGCGACTACGTGCAGCTAGAGCTCACCAAAGGCGAACGCGTGCTATGGCAAAACGAC
GCCTTTGTCATCGTCTGTCCCTGGTGGGCGGTGTGGCCATTCGAAGTCCTCATCCTACCAAAGCGTCACGTCCGA
TCCCTCGTCGATCTCTCATCCCGCGAGCGACTAGCCCTCGCCGAAGCCATGCACGAGGTGACGCGCCGATACGAC
AACCTATTCCAATGCAGCTTCCCTTACAGCTCTGGCATTCATCAGGCGCCGCTCAAGGGGACGGACGATGAGGTG
GACAACTCCTACCTGCACATGCACTTTTACCCGCCGCTTCTGCGCTCGGCTTCGGTCAAGAAGTTCTTGGTGGGA
TATGAGCTTATGGCGCAGCCGCAGCGGGATATCACGCCGGAGCAGGCGGCGGCTCGGTTGCGGGACTGCGGTGGC
GAGCTGTATCGTGTTGAGAAGAGACGGTAG
Gene >Ophcf2|06339
ATGCCAGACCAGATCCTCAACGACATTTCCCACAGGCGGTACAACCCGCTGACCGACAGCTGGCTCCTCGTCTCG
CCGCATCGCACCAAGCGTCCGTGGCAGTGGGTGCTACGCTTCGGGAGTATCTGTCTAGGCTGCGGCTGATGAGTT
TAGGGGCGCGCAGGAGGCTGCTTCGACGGAGACGCTGCCGGAGCACGATGCAAAGGTGGGCTTTTCGCTGTGGAA
ACGCGGCGTTTGTCTCGGCTTGCTGATGGTTGCAGTGCTATCTCTGTCCTGGGAATGCGCGGGCGGCTGGTGATA
GAAATCCAGACTATGAGCAGACGTTTGCCTTTGTCAACGATTACAGCGCCGTTCGAGAGGAGCAGCCTGCCTACG
AAACTGAAACTGATGGGCAAGATGTTGAATCATTGCTTCTTCGCGCAGAGGCCGTTACGGGCGTCTGCTACGTGC
TCACTTTCTCCCCCAAGCATAACCTGACGCTGGCAGACATGGCAGCCACCGAGATGGTACCGACCATCGAGCACT
GGACGCGTCTGTACGCCAACCATCTCGCGGCGTCGAATCCTCTATCCCGGCTCGCGGGGGAGCTTGAGCTGTCGA
TTCCTCGGCATGGTGCGCCTGTTCCGGGGGCTGAGTATCGGTACATGCAGATCTTTGAGAATAAGGGTGCTGCTA
TGGGATGCTCTAATCCGCATCCTCACTGTCAGGTGTGGACGACGTCGACGATGCCTGATGAGCCGGGCCGGGAGT
TGGCGCAGATGGCAAAGTATCGTGCTCGGAATGGGGGTCGTCACCTCCTAGGCGACTACGTGCAGCTAGAGCTCA
CCAAAGGCGAACGCGTGCTATGGCAAAACGACGCCTTTGTCATCGTCTGTCCCTGGTGGGCGGTGTGGCCATTCG
AAGTCCTCATCCTACCAAAGCGTCACGTCCGATCCCTCGTCGATCTCTCATCCCGCGAGCGACTAGCCCTCGCCG
AAGCCATGCACGAGGTGACGCGCCGATACGACAACCTATTCCAATGCAGCTTCCCTTACAGCTCTGGCATTCATC
AGGCGCCGCTCAAGGGGACGGACGATGAGGTGGACAACTCCTACCTGCACATGCACTTTTACCCGCCGCTTCTGC
GCTCGGCTTCGGTCAAGAAGTTCTTGGTGGGATATGAGCTTATGGCGCAGCCGCAGCGGGATATCACGCCGGAGC
AGGCGGCGGCTCGGTTGCGGGACTGCGGTGGCGAGCTGTATCGTGTTGAGAAGAGACGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail