Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06338
Gene name
Locationscaffold_07:1999171..1999742
Strand+
Gene length (bp)571
Transcript length (bp)519
Coding sequence length (bp)519
Protein length (aa) 173

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03694 Erg28 Erg28 like protein 7.7E-45 15 159

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 110 132 22
3 147 169 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06338
MDLVKSILPSANGLLPYYILTLSLISVGNSIQSYTTLHFTRRVYNGRFIRNPALPSRSASYNPEDAVDKLVPAPG
EKTSSAEDQVTPLAGRLFGTWTLITCVVRCYAAYNLHLGPVYNIALWTYVVALGHFVTELLVFRTMRFGLPQVFP
FVLASCALIWMPLARHHYVEME*
Coding >Ophcf2|06338
ATGGATCTAGTCAAGTCCATCCTCCCCTCGGCCAATGGCCTCCTCCCCTACTACATCCTCACACTCTCCCTCATC
TCCGTCGGCAACTCGATACAGTCCTACACAACGCTACACTTCACCCGACGCGTCTACAACGGCCGCTTCATCCGC
AACCCGGCGCTTCCCTCTCGATCAGCAAGCTACAACCCCGAAGACGCTGTCGATAAGCTCGTTCCCGCACCTGGG
GAGAAGACGTCATCGGCAGAAGATCAGGTCACGCCGCTCGCTGGCCGTCTGTTCGGCACGTGGACGCTCATCACG
TGCGTCGTCCGCTGCTACGCCGCTTATAACCTGCATCTGGGCCCCGTCTATAACATCGCCTTGTGGACATATGTC
GTGGCGTTGGGGCATTTTGTCACCGAGTTGTTGGTCTTTCGGACCATGCGGTTTGGGTTGCCGCAGGTGTTCCCT
TTTGTGCTTGCGAGCTGTGCTTTGATTTGGATGCCGTTGGCGCGTCATCACTACGTTGAGATGGAGTAG
Transcript >Ophcf2|06338
ATGGATCTAGTCAAGTCCATCCTCCCCTCGGCCAATGGCCTCCTCCCCTACTACATCCTCACACTCTCCCTCATC
TCCGTCGGCAACTCGATACAGTCCTACACAACGCTACACTTCACCCGACGCGTCTACAACGGCCGCTTCATCCGC
AACCCGGCGCTTCCCTCTCGATCAGCAAGCTACAACCCCGAAGACGCTGTCGATAAGCTCGTTCCCGCACCTGGG
GAGAAGACGTCATCGGCAGAAGATCAGGTCACGCCGCTCGCTGGCCGTCTGTTCGGCACGTGGACGCTCATCACG
TGCGTCGTCCGCTGCTACGCCGCTTATAACCTGCATCTGGGCCCCGTCTATAACATCGCCTTGTGGACATATGTC
GTGGCGTTGGGGCATTTTGTCACCGAGTTGTTGGTCTTTCGGACCATGCGGTTTGGGTTGCCGCAGGTGTTCCCT
TTTGTGCTTGCGAGCTGTGCTTTGATTTGGATGCCGTTGGCGCGTCATCACTACGTTGAGATGGAGTAG
Gene >Ophcf2|06338
ATGGATCTAGTCAAGTCCATCCTCCCCTCGGCCAATGGCCTCCTCCCCTACTACATCCTCACAGTCCGCCCCCTC
CCCTCAACCCAGCCAACGAAGAAACTAACCCCCCCAGCAGCTCTCCCTCATCTCCGTCGGCAACTCGATACAGTC
CTACACAACGCTACACTTCACCCGACGCGTCTACAACGGCCGCTTCATCCGCAACCCGGCGCTTCCCTCTCGATC
AGCAAGCTACAACCCCGAAGACGCTGTCGATAAGCTCGTTCCCGCACCTGGGGAGAAGACGTCATCGGCAGAAGA
TCAGGTCACGCCGCTCGCTGGCCGTCTGTTCGGCACGTGGACGCTCATCACGTGCGTCGTCCGCTGCTACGCCGC
TTATAACCTGCATCTGGGCCCCGTCTATAACATCGCCTTGTGGACATATGTCGTGGCGTTGGGGCATTTTGTCAC
CGAGTTGTTGGTCTTTCGGACCATGCGGTTTGGGTTGCCGCAGGTGTTCCCTTTTGTGCTTGCGAGCTGTGCTTT
GATTTGGATGCCGTTGGCGCGTCATCACTACGTTGAGATGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail