Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06334
Gene name
Locationscaffold_07:1990074..1991075
Strand+
Gene length (bp)1001
Transcript length (bp)867
Coding sequence length (bp)867
Protein length (aa) 289

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.9E-08 52 115
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.9E-10 118 173
PF12796 Ank_2 Ankyrin repeats (3 copies) 7.4E-09 194 279
PF00023 Ank Ankyrin repeat 3.8E-03 85 115
PF00023 Ank Ankyrin repeat 9.3E-06 118 148
PF13606 Ank_3 Ankyrin repeat 2.8E-04 85 112
PF13606 Ank_3 Ankyrin repeat 5.5E-04 118 143
PF13637 Ank_4 Ankyrin repeats (many copies) 1.0E-06 86 137
PF13637 Ank_4 Ankyrin repeats (many copies) 1.1E-05 121 171

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6983 0.565 0.228 0.1215 0.2953 0.0864 0.1479 0.2455 0.1882 0.0401

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 1.22 0.0 2.53
Alive In ants, during behavior modification 1.48 0.0 3.00
Dead In ants, recently dead 1.48 0.0 3.00

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.708307 no
Alive Dead 0.990116 no
Dead Fungus 0.714164 no

Orthologs

Orthofinder run ID4
Orthogroup6631
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06334 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3525
Ophiocordyceps subramaniannii Hirsu2|4173
Ophiocordyceps subramaniannii Hirsu2|8378

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06334
MNTASSPPYFQSAPYNVRSSIFTQQQLITPDTLTEDIEEGDPVTAEPSSGDFLHLSARLGHERIASKLLLDLEPG
AIDCENLYSGDTALHEAARRGNLCLVNVLLEQGAKISVQNHVGNYPLHLAAEEGHIAVIKNLLEKGASREAVNQD
SFTPLHLAIKNRPLEAVETLLEGQVAEIIAIKNTTGQNMALDCALRNFNEDIIKKLVEFGADLDTKDEMGQTLLH
DLASRGLTEAVSLLCGLGASSYIEDKENRTALYLAARGGHGATFQELARARNLNLNRPIVFWP*
Coding >Ophcf2|06334
ATGAATACTGCCTCGTCTCCTCCTTACTTCCAATCTGCTCCGTACAACGTCCGAAGCTCAATATTCACCCAGCAA
CAACTCATCACTCCAGACACGCTTACAGAGGACATAGAAGAAGGCGACCCTGTGACTGCAGAACCCTCGAGCGGT
GATTTCCTGCATCTCAGTGCCAGGCTCGGACACGAGCGCATCGCCAGCAAGCTTTTGCTCGACCTGGAGCCAGGT
GCCATTGACTGCGAGAACTTATACTCTGGAGATACGGCCTTGCATGAGGCTGCTCGACGAGGTAACCTCTGCCTG
GTCAATGTACTCCTGGAACAAGGAGCCAAGATCTCTGTCCAAAACCACGTCGGGAATTATCCGCTTCACCTGGCA
GCGGAAGAAGGTCATATAGCCGTCATCAAGAATCTACTCGAAAAGGGAGCCTCCCGAGAGGCGGTGAATCAAGAC
AGCTTCACGCCTCTCCACCTAGCAATCAAGAACCGGCCATTGGAGGCTGTCGAAACTCTTTTGGAAGGACAGGTT
GCTGAAATCATAGCCATCAAGAACACCACGGGTCAGAACATGGCACTCGACTGCGCGCTTCGCAACTTCAACGAA
GACATTATCAAAAAACTCGTCGAGTTCGGCGCCGACCTCGACACCAAGGACGAGATGGGCCAGACGCTGCTGCAT
GACCTCGCTTCTCGTGGCTTGACCGAAGCAGTCTCCTTGCTCTGTGGTCTCGGTGCAAGCTCGTATATAGAAGAT
AAGGAGAACCGCACAGCTCTATATCTTGCTGCCCGGGGTGGTCACGGAGCGACATTTCAGGAATTAGCCCGCGCC
AGGAATCTAAACCTGAATAGGCCCATTGTCTTCTGGCCTTGA
Transcript >Ophcf2|06334
ATGAATACTGCCTCGTCTCCTCCTTACTTCCAATCTGCTCCGTACAACGTCCGAAGCTCAATATTCACCCAGCAA
CAACTCATCACTCCAGACACGCTTACAGAGGACATAGAAGAAGGCGACCCTGTGACTGCAGAACCCTCGAGCGGT
GATTTCCTGCATCTCAGTGCCAGGCTCGGACACGAGCGCATCGCCAGCAAGCTTTTGCTCGACCTGGAGCCAGGT
GCCATTGACTGCGAGAACTTATACTCTGGAGATACGGCCTTGCATGAGGCTGCTCGACGAGGTAACCTCTGCCTG
GTCAATGTACTCCTGGAACAAGGAGCCAAGATCTCTGTCCAAAACCACGTCGGGAATTATCCGCTTCACCTGGCA
GCGGAAGAAGGTCATATAGCCGTCATCAAGAATCTACTCGAAAAGGGAGCCTCCCGAGAGGCGGTGAATCAAGAC
AGCTTCACGCCTCTCCACCTAGCAATCAAGAACCGGCCATTGGAGGCTGTCGAAACTCTTTTGGAAGGACAGGTT
GCTGAAATCATAGCCATCAAGAACACCACGGGTCAGAACATGGCACTCGACTGCGCGCTTCGCAACTTCAACGAA
GACATTATCAAAAAACTCGTCGAGTTCGGCGCCGACCTCGACACCAAGGACGAGATGGGCCAGACGCTGCTGCAT
GACCTCGCTTCTCGTGGCTTGACCGAAGCAGTCTCCTTGCTCTGTGGTCTCGGTGCAAGCTCGTATATAGAAGAT
AAGGAGAACCGCACAGCTCTATATCTTGCTGCCCGGGGTGGTCACGGAGCGACATTTCAGGAATTAGCCCGCGCC
AGGAATCTAAACCTGAATAGGCCCATTGTCTTCTGGCCTTGA
Gene >Ophcf2|06334
ATGAATACTGCCTCGTCTCCTCCTTACTTCCAATCTGCTCCGTACAACGTCCGAAGCTCAATATTCACCCAGCAA
GTGAATGAAAGATGCTCGATATGAACTCAGACAACATGGGCTTTCAGATCCGACGCAGAGTCGAAGCAACTCATC
ACTCCAGACACGCTTACAGAGGACATAGAAGAAGGCGACCCTGTGACTGCAGAACCCTCGAGCGGTGATTTCCTG
CATCTCAGTGCCAGGCTCGGACACGAGCGCATCGCCAGCAAGCTTTTGCTCGACCTGGAGCCAGGTGCCATTGAC
TGCGAGAACTTATACTCTGGAGATACGGCCTTGCATGAGGCTGCTCGACGAGGTAACCTCTGCCTGGTCAATGTA
CTCCTGGAACAAGGAGCCAAGATCTCTGTCCAAAACCACGTCGGGAATTATCCGCTTCACCTGGCAGCGGAAGAA
GGTCATATAGCCGTCATCAAGAATCTACTCGAAAAGGGAGCCTCCCGAGAGGCGGTGAATCAAGACAGCTTCACG
CCTCTCCACCTAGCAATCAAGAACCGGCCATTGGAGGCTGTCGAAACTCTTTTGGAAGGACAGGTTGCTGAAATC
ATAGCCATCAAGAACACCACGGGTCAGAACATGGCACTCGACTGCGCGCTTCGCAACTTCAACGAAGACATTATC
AAAAAACTCGTCGAGTTCGGCGCCGACCTCGACACCAAGGACGAGATGGGCCAGACGCTGCTGCATGACCTCGCT
TCTCGTGGCTTGACCGAAGCAGTCTCCTTGCTCTGTGGTCTCGGTGCAAGCTCGTATATAGAAGATAAGGAGAAC
CGCACAGCTCTATATCTTGCTGCCCGGGGTGGTCACGGAGCGACATTTCAGGAATTAGCCCGCGCCAGGAATCTA
AGTAAAAAGTTTTTTCCTTCCATGGACTTACACTGTTTCTCCCCGCTTCGAATGCTGCGGAGTGAGTAGACCTGA
ATAGGCCCATTGTCTTCTGGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail