Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06334
Gene name
Locationscaffold_07:1990074..1991075
Strand+
Gene length (bp)1001
Transcript length (bp)867
Coding sequence length (bp)867
Protein length (aa) 289

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.9E-08 52 115
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.9E-10 118 173
PF12796 Ank_2 Ankyrin repeats (3 copies) 7.4E-09 194 279
PF00023 Ank Ankyrin repeat 3.8E-03 85 115
PF00023 Ank Ankyrin repeat 9.3E-06 118 148
PF13606 Ank_3 Ankyrin repeat 2.8E-04 85 112
PF13606 Ank_3 Ankyrin repeat 5.5E-04 118 143
PF13637 Ank_4 Ankyrin repeats (many copies) 1.0E-06 86 137
PF13637 Ank_4 Ankyrin repeats (many copies) 1.1E-05 121 171

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6983 0.565 0.228 0.1215 0.2953 0.0864 0.1479 0.2455 0.1882 0.0401

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6631
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06334 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3525
Ophiocordyceps subramaniannii Hirsu2|4173
Ophiocordyceps subramaniannii Hirsu2|8378

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06334
MNTASSPPYFQSAPYNVRSSIFTQQQLITPDTLTEDIEEGDPVTAEPSSGDFLHLSARLGHERIASKLLLDLEPG
AIDCENLYSGDTALHEAARRGNLCLVNVLLEQGAKISVQNHVGNYPLHLAAEEGHIAVIKNLLEKGASREAVNQD
SFTPLHLAIKNRPLEAVETLLEGQVAEIIAIKNTTGQNMALDCALRNFNEDIIKKLVEFGADLDTKDEMGQTLLH
DLASRGLTEAVSLLCGLGASSYIEDKENRTALYLAARGGHGATFQELARARNLNLNRPIVFWP*
Coding >Ophcf2|06334
ATGAATACTGCCTCGTCTCCTCCTTACTTCCAATCTGCTCCGTACAACGTCCGAAGCTCAATATTCACCCAGCAA
CAACTCATCACTCCAGACACGCTTACAGAGGACATAGAAGAAGGCGACCCTGTGACTGCAGAACCCTCGAGCGGT
GATTTCCTGCATCTCAGTGCCAGGCTCGGACACGAGCGCATCGCCAGCAAGCTTTTGCTCGACCTGGAGCCAGGT
GCCATTGACTGCGAGAACTTATACTCTGGAGATACGGCCTTGCATGAGGCTGCTCGACGAGGTAACCTCTGCCTG
GTCAATGTACTCCTGGAACAAGGAGCCAAGATCTCTGTCCAAAACCACGTCGGGAATTATCCGCTTCACCTGGCA
GCGGAAGAAGGTCATATAGCCGTCATCAAGAATCTACTCGAAAAGGGAGCCTCCCGAGAGGCGGTGAATCAAGAC
AGCTTCACGCCTCTCCACCTAGCAATCAAGAACCGGCCATTGGAGGCTGTCGAAACTCTTTTGGAAGGACAGGTT
GCTGAAATCATAGCCATCAAGAACACCACGGGTCAGAACATGGCACTCGACTGCGCGCTTCGCAACTTCAACGAA
GACATTATCAAAAAACTCGTCGAGTTCGGCGCCGACCTCGACACCAAGGACGAGATGGGCCAGACGCTGCTGCAT
GACCTCGCTTCTCGTGGCTTGACCGAAGCAGTCTCCTTGCTCTGTGGTCTCGGTGCAAGCTCGTATATAGAAGAT
AAGGAGAACCGCACAGCTCTATATCTTGCTGCCCGGGGTGGTCACGGAGCGACATTTCAGGAATTAGCCCGCGCC
AGGAATCTAAACCTGAATAGGCCCATTGTCTTCTGGCCTTGA
Transcript >Ophcf2|06334
ATGAATACTGCCTCGTCTCCTCCTTACTTCCAATCTGCTCCGTACAACGTCCGAAGCTCAATATTCACCCAGCAA
CAACTCATCACTCCAGACACGCTTACAGAGGACATAGAAGAAGGCGACCCTGTGACTGCAGAACCCTCGAGCGGT
GATTTCCTGCATCTCAGTGCCAGGCTCGGACACGAGCGCATCGCCAGCAAGCTTTTGCTCGACCTGGAGCCAGGT
GCCATTGACTGCGAGAACTTATACTCTGGAGATACGGCCTTGCATGAGGCTGCTCGACGAGGTAACCTCTGCCTG
GTCAATGTACTCCTGGAACAAGGAGCCAAGATCTCTGTCCAAAACCACGTCGGGAATTATCCGCTTCACCTGGCA
GCGGAAGAAGGTCATATAGCCGTCATCAAGAATCTACTCGAAAAGGGAGCCTCCCGAGAGGCGGTGAATCAAGAC
AGCTTCACGCCTCTCCACCTAGCAATCAAGAACCGGCCATTGGAGGCTGTCGAAACTCTTTTGGAAGGACAGGTT
GCTGAAATCATAGCCATCAAGAACACCACGGGTCAGAACATGGCACTCGACTGCGCGCTTCGCAACTTCAACGAA
GACATTATCAAAAAACTCGTCGAGTTCGGCGCCGACCTCGACACCAAGGACGAGATGGGCCAGACGCTGCTGCAT
GACCTCGCTTCTCGTGGCTTGACCGAAGCAGTCTCCTTGCTCTGTGGTCTCGGTGCAAGCTCGTATATAGAAGAT
AAGGAGAACCGCACAGCTCTATATCTTGCTGCCCGGGGTGGTCACGGAGCGACATTTCAGGAATTAGCCCGCGCC
AGGAATCTAAACCTGAATAGGCCCATTGTCTTCTGGCCTTGA
Gene >Ophcf2|06334
ATGAATACTGCCTCGTCTCCTCCTTACTTCCAATCTGCTCCGTACAACGTCCGAAGCTCAATATTCACCCAGCAA
GTGAATGAAAGATGCTCGATATGAACTCAGACAACATGGGCTTTCAGATCCGACGCAGAGTCGAAGCAACTCATC
ACTCCAGACACGCTTACAGAGGACATAGAAGAAGGCGACCCTGTGACTGCAGAACCCTCGAGCGGTGATTTCCTG
CATCTCAGTGCCAGGCTCGGACACGAGCGCATCGCCAGCAAGCTTTTGCTCGACCTGGAGCCAGGTGCCATTGAC
TGCGAGAACTTATACTCTGGAGATACGGCCTTGCATGAGGCTGCTCGACGAGGTAACCTCTGCCTGGTCAATGTA
CTCCTGGAACAAGGAGCCAAGATCTCTGTCCAAAACCACGTCGGGAATTATCCGCTTCACCTGGCAGCGGAAGAA
GGTCATATAGCCGTCATCAAGAATCTACTCGAAAAGGGAGCCTCCCGAGAGGCGGTGAATCAAGACAGCTTCACG
CCTCTCCACCTAGCAATCAAGAACCGGCCATTGGAGGCTGTCGAAACTCTTTTGGAAGGACAGGTTGCTGAAATC
ATAGCCATCAAGAACACCACGGGTCAGAACATGGCACTCGACTGCGCGCTTCGCAACTTCAACGAAGACATTATC
AAAAAACTCGTCGAGTTCGGCGCCGACCTCGACACCAAGGACGAGATGGGCCAGACGCTGCTGCATGACCTCGCT
TCTCGTGGCTTGACCGAAGCAGTCTCCTTGCTCTGTGGTCTCGGTGCAAGCTCGTATATAGAAGATAAGGAGAAC
CGCACAGCTCTATATCTTGCTGCCCGGGGTGGTCACGGAGCGACATTTCAGGAATTAGCCCGCGCCAGGAATCTA
AGTAAAAAGTTTTTTCCTTCCATGGACTTACACTGTTTCTCCCCGCTTCGAATGCTGCGGAGTGAGTAGACCTGA
ATAGGCCCATTGTCTTCTGGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail