Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06319
Gene name
Locationscaffold_07:1936037..1941604
Strand-
Gene length (bp)5567
Transcript length (bp)5454
Coding sequence length (bp)5454
Protein length (aa) 1818

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.9E-06 1389 1458

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6201 0.5428 0.1766 0.0951 0.4154 0.0666 0.0811 0.1995 0.1715 0.0366

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 10.21 5.66 14.76
Alive In ants, during behavior modification 10.32 5.56 15.09
Dead In ants, recently dead 6.58 3.39 9.77

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.966530 no
Alive Dead 0.007612 yes
Dead Fungus 0.028452 yes

Orthologs

Orthofinder run ID4
Orthogroup2927
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7618
Ophiocordyceps australis map64 (Brazil) OphauB2|7198
Ophiocordyceps camponoti-floridani Ophcf2|06319 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3012
Ophiocordyceps kimflemingae Ophio5|955
Ophiocordyceps subramaniannii Hirsu2|4910

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06319
MSAATTSHHRHRRLAQLCEHWDIAPFETPAPLPPATPPPSFRTAADEQLAEDFLQRRAADGAHARPKGVIRQAFS
SAGLRKGKTWDPSHVLDGLTTWVANAGSPGVAEALAVKLVAAGVHLVDTQKQKGAGILNKRRTLDPHDVRVRLLR
LAVIAKNIQLAQVLLPYSDPAVLDACLPYAIRGGDGAMTELLLVQGASAAYSREGQDAFRQACTIHGHSQLVSLV
LRSVRHPEESWMSMAMCDAARAGCFDAVLLLSRSTADGNYNQAEALRSAVCSGRQDIALAIVIGSNPPQRSALNK
ALHTIQRDSSLQPATKFKLVEVLLCAGAGGVSASQALEKYYQADFLDMAALLAQYGAAAEYEDAAVLKSAVARGE
MVLVEAFLRLPGAISSATASTCVSLIAEDASFDRRHAILSLLLRQGANGQALDQMLVDAAKAGDSKSVDLLLTPF
FPAVSPRCSTNPNRHAVATVDYNSGEALCAAMLRVDLHMTRKILSRQPSPATLAAVFPLTKQLSNEDRCPMTELF
VQSSLPSACLENALVEAVNVCASERDVTLITLLLRYESEINFSHGTGLSSLIKEVDLKLLEPLLQSITPKTAAAH
LQDMMDVEDRPTRAHVAAMLLRAGADKGIDQIASTLLAVLAEDPVDLELLTMLLEQGRADINVLKGAVINKAVVH
PNPEVLDLVINKGEPSTSSITRALRALMPLPSTEDKARKLETLLDRSTRRQDVNSMLVHEVKSIAQSSLDSPSLS
TMKHLLEAGADMNAHNAAALCHAVIGAKAEVVSIMIRWRLSPTPTALGTALPHALRIIDVAKRLELTTSLVDAGV
FAEEAGRALYYATANFSTDLSLIGVLAAAADPSDGEALVLSASMESSEAMDVILANCTSSADARSSAMDLAVSAK
SKEARSKMCRSLLAAGVSNEAASNALLSAAHDADVELCDMLVAHGAVTGRRGGQAVIEACRRGSAEVLKVLLKVL
PGTDDDGQKMLKAAFQAATEVSDLNRRAVIFEQLLSQGLSGDLVDAQLYPAARYGEDGMAVLRVLLAAGANPNHN
DGECVFSTASCAFVAPLDLLLGLETGENHQKRASQPTLLRALDACWSLHRDARYHIVDSLFRAGLCPCDELHRRL
NDAVNEEDVEERLVKLLLDHGASPSFDDGRTLKDAARKMASPILALVLKTNLSQGRITEAFGEAFSVGNFDNWFT
DAGLGTARLLVDKFSDGQTLGRALMLVMKKSSTETRELADAFFDLLMARGPDVDYNGGELLQQAASKAERAWTRR
LLQCHPSTETVSRAIQRIFDTETSQEDVLDLFRMFGEYRECEIDLVTDQQGYEPMVKRAIDQYPRSTMVLKTLLD
AGFYHDQATRCQIYPETGEEEVSTPLLWAIAQPQKRVSTSVIELLIQRGAKVNAESSTSRTTPLMLATQTRRPDV
VKSLLDHGADGDAIDRQGRTSLCIASNASGEVAVQLMTMLLAAEPSKDDGSLHNAARNLDLPAVTLLVEAGHDAD
FPSPLHGGRSALGEVCLHGSDAGEMTALRERAMLKVMGLLMSGNSDLTIKSNGMSFLQLCFEATDAVTTTRALLK
SGMWKHVNKAFNRITLNGYTYSPTMYISKVLGRSSVNIQLLAVLRASRATDMFYASEGPQPDGAIGLPEEVEAED
RARRARLTRIAIESEDFDMAMACKRQLARVEQQMAAQQDEADDRRHRNRHDHVLEAIQSRALAMEAVATAAHQRR
LAEQRALAEVSIGSARAVAATELEAEDARRRKTFGWEPRRFGSSAGGFEVSVAEERGDGDGQKRLLLVDGLRRES
RLLEEKRASVGYVVELD*
Coding >Ophcf2|06319
ATGTCGGCCGCGACGACGTCTCATCACCGCCATCGACGCCTCGCCCAGCTGTGTGAGCACTGGGACATTGCGCCT
TTCGAGACGCCGGCTCCTCTACCGCCTGCTACGCCGCCGCCTTCGTTTCGCACCGCGGCAGATGAGCAGCTGGCG
GAGGATTTCCTGCAGCGACGCGCCGCCGATGGCGCTCATGCTCGTCCCAAGGGTGTCATCCGCCAGGCCTTTTCC
TCGGCTGGTCTCCGGAAGGGGAAGACGTGGGATCCCAGCCATGTGCTGGACGGTCTGACGACTTGGGTGGCCAAT
GCTGGCTCTCCGGGTGTTGCTGAGGCTCTGGCCGTCAAGCTGGTCGCTGCTGGTGTTCATCTGGTCGACACGCAG
AAGCAAAAGGGTGCCGGAATTCTCAATAAGCGTCGGACCCTCGATCCTCACGATGTCCGTGTTCGGCTGCTTCGT
CTCGCCGTCATCGCCAAGAACATTCAGCTGGCGCAGGTTCTGCTACCGTACTCGGATCCCGCTGTTCTGGACGCC
TGCTTGCCGTACGCCATCCGCGGCGGTGACGGCGCCATGACGGAGCTGTTGCTCGTTCAGGGCGCCAGTGCTGCT
TATAGCCGCGAGGGCCAGGATGCCTTTCGCCAGGCTTGCACTATTCACGGCCACTCACAGCTCGTCAGCCTCGTC
CTCCGCTCTGTGCGTCATCCGGAGGAGTCGTGGATGTCCATGGCCATGTGCGACGCCGCCCGCGCCGGTTGCTTC
GACGCCGTCTTGCTTCTCAGCCGCTCCACTGCCGACGGAAACTACAACCAGGCCGAGGCGTTGCGATCTGCGGTC
TGCTCGGGAAGACAAGACATTGCCCTGGCCATCGTCATCGGGAGCAATCCGCCTCAGAGATCAGCTCTCAACAAA
GCTCTCCACACCATCCAACGCGACTCTTCTCTCCAGCCGGCCACCAAGTTCAAGCTCGTCGAAGTCCTCCTCTGC
GCTGGAGCCGGCGGCGTCAGTGCCTCGCAGGCGCTCGAAAAGTATTATCAGGCCGACTTTCTCGACATGGCAGCC
TTGCTGGCCCAGTACGGTGCGGCCGCCGAGTATGAGGACGCGGCCGTACTCAAGTCGGCCGTTGCTCGCGGAGAG
ATGGTCCTCGTCGAGGCTTTCCTCCGTCTGCCTGGTGCCATCAGCTCAGCTACAGCGTCGACTTGCGTGTCTCTG
ATAGCAGAAGATGCCTCTTTCGACCGGCGCCATGCCATTCTCAGCCTCCTGCTGCGGCAAGGTGCCAATGGCCAG
GCTCTCGATCAGATGCTTGTCGACGCAGCAAAGGCAGGCGACTCCAAGTCGGTCGACCTGCTGCTCACCCCCTTC
TTCCCCGCCGTTTCTCCTCGTTGCTCGACGAATCCCAACAGGCACGCGGTAGCGACGGTCGACTACAACTCGGGC
GAAGCTCTCTGCGCCGCTATGCTTCGCGTCGATCTGCACATGACGCGCAAGATTCTGTCCAGACAGCCCTCTCCA
GCGACCCTGGCGGCTGTCTTTCCGCTGACGAAACAGTTGTCCAACGAGGACAGGTGTCCGATGACGGAACTGTTC
GTCCAGAGCTCGCTGCCCAGTGCGTGCCTCGAGAATGCCCTAGTCGAGGCCGTCAACGTGTGTGCTTCCGAAAGA
GACGTTACCCTCATCACCCTGCTTTTGAGATATGAATCCGAGATCAACTTCAGCCACGGGACTGGCCTGTCCTCT
CTCATCAAAGAGGTCGATCTGAAGCTGCTGGAACCCTTGCTGCAGAGCATCACACCCAAGACGGCAGCAGCTCAT
CTACAGGACATGATGGACGTTGAGGATCGCCCGACGCGTGCTCACGTGGCGGCCATGCTGCTTCGTGCTGGAGCC
GACAAGGGCATCGATCAGATCGCGTCTACGCTGCTGGCAGTGCTGGCAGAGGACCCGGTCGACCTGGAGCTCTTG
ACCATGCTCCTCGAGCAGGGACGCGCAGACATCAATGTCCTGAAAGGTGCCGTCATCAACAAAGCCGTCGTCCAC
CCGAACCCCGAGGTCCTCGATCTCGTCATCAACAAAGGAGAGCCGTCGACGTCGTCCATCACCCGGGCGTTGAGG
GCGCTGATGCCGCTTCCGTCGACTGAAGATAAGGCGCGGAAGCTCGAAACCCTACTGGACAGGTCGACCCGAAGG
CAAGACGTCAACTCGATGCTGGTACACGAGGTCAAGTCCATTGCTCAGAGCAGCCTGGACTCGCCGTCTCTGTCG
ACCATGAAGCATCTGCTGGAAGCCGGAGCCGATATGAACGCGCACAACGCGGCGGCCCTTTGCCATGCCGTCATT
GGGGCCAAGGCAGAAGTGGTCAGCATCATGATCCGCTGGCGACTGTCCCCGACTCCTACGGCTCTGGGCACCGCG
CTGCCACACGCTCTGCGCATCATCGACGTCGCGAAGCGGTTAGAACTGACGACCTCGTTGGTCGATGCCGGCGTC
TTCGCCGAAGAAGCCGGCCGGGCCCTGTATTACGCCACGGCCAACTTTTCAACCGACCTGTCTCTCATCGGCGTC
CTGGCCGCCGCCGCAGATCCGTCCGACGGTGAGGCGCTCGTCTTGTCCGCCTCGATGGAGTCGTCCGAGGCCATG
GACGTGATTCTCGCCAACTGCACTTCTTCCGCAGACGCTCGGAGCTCGGCCATGGACCTGGCTGTGTCGGCCAAG
AGCAAGGAAGCGCGGAGCAAGATGTGCCGAAGTCTTCTGGCCGCTGGCGTGTCGAACGAGGCTGCATCGAACGCT
CTCCTATCCGCCGCCCACGACGCCGACGTCGAGCTGTGCGACATGCTCGTGGCTCACGGCGCGGTCACGGGGAGG
CGAGGCGGCCAAGCCGTCATCGAAGCCTGCCGAAGGGGATCCGCCGAAGTCCTCAAAGTTCTCCTCAAGGTCCTT
CCCGGAACCGACGACGATGGCCAGAAGATGCTGAAGGCGGCGTTCCAGGCCGCGACAGAGGTCAGCGACTTGAAC
AGGCGAGCCGTCATCTTTGAGCAGCTCCTGAGCCAGGGCCTCAGCGGAGACCTGGTCGACGCTCAGCTGTATCCG
GCAGCAAGGTACGGCGAGGACGGCATGGCCGTCTTGAGAGTTCTCCTGGCCGCAGGGGCGAATCCCAATCACAAT
GACGGAGAGTGCGTCTTTTCCACGGCCAGCTGTGCGTTTGTGGCCCCCCTCGACCTGCTTCTTGGACTGGAGACC
GGAGAGAACCATCAGAAGAGAGCATCACAGCCGACGCTTCTCAGGGCGCTTGACGCCTGTTGGAGCCTTCATCGC
GATGCACGATATCACATCGTGGACAGCCTGTTTAGGGCCGGCCTGTGCCCTTGCGATGAATTGCACCGGAGGCTC
AACGATGCCGTCAACGAGGAAGACGTCGAGGAGCGTCTGGTGAAGTTGCTTCTTGATCACGGCGCGTCCCCATCT
TTTGATGATGGCAGGACGCTCAAGGATGCCGCCCGGAAAATGGCATCACCGATTCTGGCCCTCGTTCTGAAGACG
AATCTGTCGCAGGGGCGGATCACGGAGGCCTTTGGCGAGGCGTTTTCTGTGGGCAACTTTGACAATTGGTTCACT
GACGCCGGGCTCGGGACTGCGAGACTCCTGGTGGACAAGTTTAGCGACGGACAAACTCTGGGCCGAGCCCTGATG
CTGGTCATGAAGAAGTCGTCGACGGAGACTCGGGAACTGGCTGACGCCTTCTTCGACTTGCTGATGGCTCGCGGG
CCAGACGTCGATTACAACGGTGGAGAGCTTCTGCAGCAAGCCGCGTCCAAGGCGGAGCGGGCCTGGACGAGGCGG
CTCTTACAATGCCATCCGTCGACAGAAACGGTGTCCCGTGCAATTCAGCGCATCTTCGACACGGAAACCAGCCAG
GAGGACGTTCTGGATCTCTTTAGGATGTTTGGCGAATACCGCGAGTGCGAGATTGACCTCGTGACGGACCAGCAG
GGCTACGAGCCGATGGTCAAGAGAGCCATCGACCAGTACCCGAGGTCGACCATGGTGCTGAAGACGCTGCTTGAC
GCGGGATTCTATCACGACCAAGCAACGCGGTGCCAGATTTACCCCGAGACGGGGGAGGAGGAGGTGTCGACGCCA
CTGCTCTGGGCCATTGCCCAACCGCAGAAACGGGTCAGCACGTCGGTTATTGAGCTGCTGATCCAGCGGGGAGCC
AAGGTCAATGCCGAATCGAGCACGTCTCGGACGACTCCGTTGATGCTGGCGACGCAGACAAGACGGCCTGACGTG
GTCAAGTCATTGCTTGATCACGGCGCTGATGGGGATGCTATCGACCGTCAGGGGCGGACGTCGCTCTGCATAGCG
TCCAATGCCAGTGGAGAGGTGGCCGTACAGCTGATGACGATGCTGCTGGCAGCAGAACCCTCCAAGGACGACGGG
TCCCTTCACAATGCGGCCCGGAATCTCGACCTGCCGGCCGTGACGCTGCTCGTCGAGGCGGGCCACGACGCGGAC
TTTCCGAGCCCGCTCCACGGCGGCCGAAGCGCGCTCGGCGAGGTCTGCCTTCACGGGTCGGACGCGGGAGAGATG
ACGGCATTGAGGGAACGGGCCATGCTCAAGGTCATGGGCCTGCTGATGTCGGGCAACTCGGACCTGACGATCAAG
TCCAACGGAATGTCGTTTCTGCAGCTGTGCTTCGAAGCCACGGACGCAGTGACGACGACGCGAGCGCTGCTCAAG
AGCGGCATGTGGAAGCACGTCAACAAGGCCTTTAACCGAATCACGCTCAACGGCTACACGTACTCGCCAACCATG
TACATCTCCAAGGTGCTGGGCCGGTCGAGCGTCAACATTCAGTTGCTGGCGGTGCTGCGGGCCAGCCGGGCGACG
GACATGTTTTACGCCAGCGAGGGTCCGCAGCCGGACGGGGCGATCGGTCTCCCGGAGGAGGTCGAAGCCGAGGAC
CGGGCTCGAAGGGCTCGGCTGACGCGCATCGCCATCGAGTCGGAGGATTTCGACATGGCCATGGCTTGCAAGCGG
CAGTTGGCCCGGGTCGAGCAGCAGATGGCGGCTCAGCAGGACGAAGCCGACGACCGACGTCATCGCAACAGACAC
GACCACGTGCTCGAAGCCATCCAGTCTCGCGCCCTGGCCATGGAGGCCGTAGCAACGGCAGCGCACCAGCGAAGA
CTCGCCGAGCAACGCGCCCTGGCAGAAGTGTCCATCGGAAGCGCCCGTGCGGTAGCGGCGACGGAGCTCGAGGCC
GAAGACGCCCGTCGGCGCAAGACGTTTGGATGGGAGCCTCGACGGTTCGGCAGCTCGGCTGGGGGGTTTGAGGTG
TCGGTCGCGGAGGAGAGGGGGGATGGCGATGGGCAGAAGCGGTTGTTGCTGGTCGATGGATTGAGGAGGGAGTCG
AGGTTGCTGGAGGAGAAGAGGGCTTCTGTTGGCTATGTTGTGGAGTTGGATTAA
Transcript >Ophcf2|06319
ATGTCGGCCGCGACGACGTCTCATCACCGCCATCGACGCCTCGCCCAGCTGTGTGAGCACTGGGACATTGCGCCT
TTCGAGACGCCGGCTCCTCTACCGCCTGCTACGCCGCCGCCTTCGTTTCGCACCGCGGCAGATGAGCAGCTGGCG
GAGGATTTCCTGCAGCGACGCGCCGCCGATGGCGCTCATGCTCGTCCCAAGGGTGTCATCCGCCAGGCCTTTTCC
TCGGCTGGTCTCCGGAAGGGGAAGACGTGGGATCCCAGCCATGTGCTGGACGGTCTGACGACTTGGGTGGCCAAT
GCTGGCTCTCCGGGTGTTGCTGAGGCTCTGGCCGTCAAGCTGGTCGCTGCTGGTGTTCATCTGGTCGACACGCAG
AAGCAAAAGGGTGCCGGAATTCTCAATAAGCGTCGGACCCTCGATCCTCACGATGTCCGTGTTCGGCTGCTTCGT
CTCGCCGTCATCGCCAAGAACATTCAGCTGGCGCAGGTTCTGCTACCGTACTCGGATCCCGCTGTTCTGGACGCC
TGCTTGCCGTACGCCATCCGCGGCGGTGACGGCGCCATGACGGAGCTGTTGCTCGTTCAGGGCGCCAGTGCTGCT
TATAGCCGCGAGGGCCAGGATGCCTTTCGCCAGGCTTGCACTATTCACGGCCACTCACAGCTCGTCAGCCTCGTC
CTCCGCTCTGTGCGTCATCCGGAGGAGTCGTGGATGTCCATGGCCATGTGCGACGCCGCCCGCGCCGGTTGCTTC
GACGCCGTCTTGCTTCTCAGCCGCTCCACTGCCGACGGAAACTACAACCAGGCCGAGGCGTTGCGATCTGCGGTC
TGCTCGGGAAGACAAGACATTGCCCTGGCCATCGTCATCGGGAGCAATCCGCCTCAGAGATCAGCTCTCAACAAA
GCTCTCCACACCATCCAACGCGACTCTTCTCTCCAGCCGGCCACCAAGTTCAAGCTCGTCGAAGTCCTCCTCTGC
GCTGGAGCCGGCGGCGTCAGTGCCTCGCAGGCGCTCGAAAAGTATTATCAGGCCGACTTTCTCGACATGGCAGCC
TTGCTGGCCCAGTACGGTGCGGCCGCCGAGTATGAGGACGCGGCCGTACTCAAGTCGGCCGTTGCTCGCGGAGAG
ATGGTCCTCGTCGAGGCTTTCCTCCGTCTGCCTGGTGCCATCAGCTCAGCTACAGCGTCGACTTGCGTGTCTCTG
ATAGCAGAAGATGCCTCTTTCGACCGGCGCCATGCCATTCTCAGCCTCCTGCTGCGGCAAGGTGCCAATGGCCAG
GCTCTCGATCAGATGCTTGTCGACGCAGCAAAGGCAGGCGACTCCAAGTCGGTCGACCTGCTGCTCACCCCCTTC
TTCCCCGCCGTTTCTCCTCGTTGCTCGACGAATCCCAACAGGCACGCGGTAGCGACGGTCGACTACAACTCGGGC
GAAGCTCTCTGCGCCGCTATGCTTCGCGTCGATCTGCACATGACGCGCAAGATTCTGTCCAGACAGCCCTCTCCA
GCGACCCTGGCGGCTGTCTTTCCGCTGACGAAACAGTTGTCCAACGAGGACAGGTGTCCGATGACGGAACTGTTC
GTCCAGAGCTCGCTGCCCAGTGCGTGCCTCGAGAATGCCCTAGTCGAGGCCGTCAACGTGTGTGCTTCCGAAAGA
GACGTTACCCTCATCACCCTGCTTTTGAGATATGAATCCGAGATCAACTTCAGCCACGGGACTGGCCTGTCCTCT
CTCATCAAAGAGGTCGATCTGAAGCTGCTGGAACCCTTGCTGCAGAGCATCACACCCAAGACGGCAGCAGCTCAT
CTACAGGACATGATGGACGTTGAGGATCGCCCGACGCGTGCTCACGTGGCGGCCATGCTGCTTCGTGCTGGAGCC
GACAAGGGCATCGATCAGATCGCGTCTACGCTGCTGGCAGTGCTGGCAGAGGACCCGGTCGACCTGGAGCTCTTG
ACCATGCTCCTCGAGCAGGGACGCGCAGACATCAATGTCCTGAAAGGTGCCGTCATCAACAAAGCCGTCGTCCAC
CCGAACCCCGAGGTCCTCGATCTCGTCATCAACAAAGGAGAGCCGTCGACGTCGTCCATCACCCGGGCGTTGAGG
GCGCTGATGCCGCTTCCGTCGACTGAAGATAAGGCGCGGAAGCTCGAAACCCTACTGGACAGGTCGACCCGAAGG
CAAGACGTCAACTCGATGCTGGTACACGAGGTCAAGTCCATTGCTCAGAGCAGCCTGGACTCGCCGTCTCTGTCG
ACCATGAAGCATCTGCTGGAAGCCGGAGCCGATATGAACGCGCACAACGCGGCGGCCCTTTGCCATGCCGTCATT
GGGGCCAAGGCAGAAGTGGTCAGCATCATGATCCGCTGGCGACTGTCCCCGACTCCTACGGCTCTGGGCACCGCG
CTGCCACACGCTCTGCGCATCATCGACGTCGCGAAGCGGTTAGAACTGACGACCTCGTTGGTCGATGCCGGCGTC
TTCGCCGAAGAAGCCGGCCGGGCCCTGTATTACGCCACGGCCAACTTTTCAACCGACCTGTCTCTCATCGGCGTC
CTGGCCGCCGCCGCAGATCCGTCCGACGGTGAGGCGCTCGTCTTGTCCGCCTCGATGGAGTCGTCCGAGGCCATG
GACGTGATTCTCGCCAACTGCACTTCTTCCGCAGACGCTCGGAGCTCGGCCATGGACCTGGCTGTGTCGGCCAAG
AGCAAGGAAGCGCGGAGCAAGATGTGCCGAAGTCTTCTGGCCGCTGGCGTGTCGAACGAGGCTGCATCGAACGCT
CTCCTATCCGCCGCCCACGACGCCGACGTCGAGCTGTGCGACATGCTCGTGGCTCACGGCGCGGTCACGGGGAGG
CGAGGCGGCCAAGCCGTCATCGAAGCCTGCCGAAGGGGATCCGCCGAAGTCCTCAAAGTTCTCCTCAAGGTCCTT
CCCGGAACCGACGACGATGGCCAGAAGATGCTGAAGGCGGCGTTCCAGGCCGCGACAGAGGTCAGCGACTTGAAC
AGGCGAGCCGTCATCTTTGAGCAGCTCCTGAGCCAGGGCCTCAGCGGAGACCTGGTCGACGCTCAGCTGTATCCG
GCAGCAAGGTACGGCGAGGACGGCATGGCCGTCTTGAGAGTTCTCCTGGCCGCAGGGGCGAATCCCAATCACAAT
GACGGAGAGTGCGTCTTTTCCACGGCCAGCTGTGCGTTTGTGGCCCCCCTCGACCTGCTTCTTGGACTGGAGACC
GGAGAGAACCATCAGAAGAGAGCATCACAGCCGACGCTTCTCAGGGCGCTTGACGCCTGTTGGAGCCTTCATCGC
GATGCACGATATCACATCGTGGACAGCCTGTTTAGGGCCGGCCTGTGCCCTTGCGATGAATTGCACCGGAGGCTC
AACGATGCCGTCAACGAGGAAGACGTCGAGGAGCGTCTGGTGAAGTTGCTTCTTGATCACGGCGCGTCCCCATCT
TTTGATGATGGCAGGACGCTCAAGGATGCCGCCCGGAAAATGGCATCACCGATTCTGGCCCTCGTTCTGAAGACG
AATCTGTCGCAGGGGCGGATCACGGAGGCCTTTGGCGAGGCGTTTTCTGTGGGCAACTTTGACAATTGGTTCACT
GACGCCGGGCTCGGGACTGCGAGACTCCTGGTGGACAAGTTTAGCGACGGACAAACTCTGGGCCGAGCCCTGATG
CTGGTCATGAAGAAGTCGTCGACGGAGACTCGGGAACTGGCTGACGCCTTCTTCGACTTGCTGATGGCTCGCGGG
CCAGACGTCGATTACAACGGTGGAGAGCTTCTGCAGCAAGCCGCGTCCAAGGCGGAGCGGGCCTGGACGAGGCGG
CTCTTACAATGCCATCCGTCGACAGAAACGGTGTCCCGTGCAATTCAGCGCATCTTCGACACGGAAACCAGCCAG
GAGGACGTTCTGGATCTCTTTAGGATGTTTGGCGAATACCGCGAGTGCGAGATTGACCTCGTGACGGACCAGCAG
GGCTACGAGCCGATGGTCAAGAGAGCCATCGACCAGTACCCGAGGTCGACCATGGTGCTGAAGACGCTGCTTGAC
GCGGGATTCTATCACGACCAAGCAACGCGGTGCCAGATTTACCCCGAGACGGGGGAGGAGGAGGTGTCGACGCCA
CTGCTCTGGGCCATTGCCCAACCGCAGAAACGGGTCAGCACGTCGGTTATTGAGCTGCTGATCCAGCGGGGAGCC
AAGGTCAATGCCGAATCGAGCACGTCTCGGACGACTCCGTTGATGCTGGCGACGCAGACAAGACGGCCTGACGTG
GTCAAGTCATTGCTTGATCACGGCGCTGATGGGGATGCTATCGACCGTCAGGGGCGGACGTCGCTCTGCATAGCG
TCCAATGCCAGTGGAGAGGTGGCCGTACAGCTGATGACGATGCTGCTGGCAGCAGAACCCTCCAAGGACGACGGG
TCCCTTCACAATGCGGCCCGGAATCTCGACCTGCCGGCCGTGACGCTGCTCGTCGAGGCGGGCCACGACGCGGAC
TTTCCGAGCCCGCTCCACGGCGGCCGAAGCGCGCTCGGCGAGGTCTGCCTTCACGGGTCGGACGCGGGAGAGATG
ACGGCATTGAGGGAACGGGCCATGCTCAAGGTCATGGGCCTGCTGATGTCGGGCAACTCGGACCTGACGATCAAG
TCCAACGGAATGTCGTTTCTGCAGCTGTGCTTCGAAGCCACGGACGCAGTGACGACGACGCGAGCGCTGCTCAAG
AGCGGCATGTGGAAGCACGTCAACAAGGCCTTTAACCGAATCACGCTCAACGGCTACACGTACTCGCCAACCATG
TACATCTCCAAGGTGCTGGGCCGGTCGAGCGTCAACATTCAGTTGCTGGCGGTGCTGCGGGCCAGCCGGGCGACG
GACATGTTTTACGCCAGCGAGGGTCCGCAGCCGGACGGGGCGATCGGTCTCCCGGAGGAGGTCGAAGCCGAGGAC
CGGGCTCGAAGGGCTCGGCTGACGCGCATCGCCATCGAGTCGGAGGATTTCGACATGGCCATGGCTTGCAAGCGG
CAGTTGGCCCGGGTCGAGCAGCAGATGGCGGCTCAGCAGGACGAAGCCGACGACCGACGTCATCGCAACAGACAC
GACCACGTGCTCGAAGCCATCCAGTCTCGCGCCCTGGCCATGGAGGCCGTAGCAACGGCAGCGCACCAGCGAAGA
CTCGCCGAGCAACGCGCCCTGGCAGAAGTGTCCATCGGAAGCGCCCGTGCGGTAGCGGCGACGGAGCTCGAGGCC
GAAGACGCCCGTCGGCGCAAGACGTTTGGATGGGAGCCTCGACGGTTCGGCAGCTCGGCTGGGGGGTTTGAGGTG
TCGGTCGCGGAGGAGAGGGGGGATGGCGATGGGCAGAAGCGGTTGTTGCTGGTCGATGGATTGAGGAGGGAGTCG
AGGTTGCTGGAGGAGAAGAGGGCTTCTGTTGGCTATGTTGTGGAGTTGGATTAA
Gene >Ophcf2|06319
ATGTCGGCCGCGACGACGTCTCATCACCGCCATCGACGCCTCGCCCAGCTGTGTGAGCACTGGGACATTGCGCCT
TTCGAGACGCCGGCTCCTCTACCGCCTGCTACGCCGCCGCCTTCGTTTCGCACCGCGGCAGATGAGCAGCTGGCG
GAGGATTTCCTGCAGCGACGCGCCGCCGATGGCGCTCATGCTCGTCCCAAGGGTGTCATCCGCCAGGCCTTTTCC
TCGGCTGGTCTCCGGAAGGGGAAGACGTGGGATCCCAGCCATGTGCTGGACGGTCTGACGACTTGGGTGGCCAAT
GCTGGCTCTCCGGGTGTTGCTGAGGCTCTGGCCGTCAAGCTGGTCGCTGCTGGTGTTCATCTGGTCGACACGCAG
AAGCAAAAGGGTGCCGGAATTCTCAATAAGCGTCGGACCCTCGATCCTCACGATGTCCGTGTTCGGCTGCTTCGT
CTCGCCGTCATCGCCAAGAACATTCAGCTGGCGCAGGTTCTGCTACCGTACTCGGATCCCGCTGTTCTGGACGCC
TGCTTGCCGTACGCCATCCGCGGCGGTGACGGCGCCATGACGGAGCTGTTGCTCGTTCAGGGCGCCAGTGCTGCT
TATAGCCGCGAGGGCCAGGATGCCTTTCGCCAGGCTTGCACTATTCACGGCCACTCACAGCTCGTCAGCCTCGTC
CTCCGCTCTGTGCGTCATCCGGAGGAGTCGTGGATGTCCATGGCCATGTGCGACGCCGCCCGCGCCGGTTGCTTC
GACGCCGTCTTGCTTCTCAGCCGCTCCACTGCCGACGGAAACTACAACCAGGCCGAGGCGTTGCGATCTGCGGTC
TGCTCGGGAAGACAAGACATTGCCCTGGCCATCGTCATCGGGAGCAATCCGCCTCAGAGATCAGCTCTCAACAAA
GCTCTCCACACCATCCAACGCGACTCTTCTCTCCAGCCGGCCACCAAGTTCAAGCTCGTCGAAGTCCTCCTCTGC
GCTGGAGCCGGCGGCGTCAGTGCCTCGCAGGCGCTCGAAAAGTATTATCAGGCCGACTTTCTCGACATGGCAGCC
TTGCTGGCCCAGTACGGTGCGGCCGCCGAGTATGAGGACGCGGCCGTACTCAAGTCGGCCGTTGCTCGCGGAGAG
ATGGTCCTCGTCGAGGCTTTCCTCCGTCTGCCTGGTGCCATCAGCTCAGCTACAGCGTCGACTTGCGTGTCTCTG
ATAGCAGAAGATGCCTCTTTCGACCGGCGCCATGCCATTCTCAGCCTCCTGCTGCGGCAAGGTGCCAATGGCCAG
GCTCTCGATCAGATGCTTGTCGACGCAGCAAAGGCAGGCGACTCCAAGTCGGTCGACCTGCTGCTCACCCCCTTC
TTCCCCGCCGTTTCTCCTCGTTGCTCGACGAATCCCAACAGGCACGCGGTAGCGACGGTCGACTACAACTCGGGC
GAAGCTCTCTGCGCCGCTATGCTTCGCGTCGATCTGCACATGACGCGCAAGATTCTGTCCAGACAGCCCTCTCCA
GCGACCCTGGCGGCTGTCTTTCCGCTGACGAAACAGTTGTCCAACGAGGACAGGTGTCCGATGACGGAACTGTTC
GTCCAGAGCTCGCTGCCCAGTGCGTGCCTCGAGAATGCCCTAGTCGAGGCCGTCAACGTGTGTGCTTCCGAAAGA
GACGTTACCCTCATCACCCTGCTTTTGAGATATGAATCCGAGATCAACTTCAGCCACGGGACTGGCCTGTCCTCT
CTCATCAAAGAGGTCGATCTGAAGCTGCTGGAACCCTTGCTGCAGAGCATCACACCCAAGACGGCAGCAGCTCAT
CTACAGGACATGATGGACGTTGAGGATCGCCCGACGCGTGCTCACGTGGCGGCCATGCTGCTTCGTGCTGGAGCC
GACAAGGGCATCGATCAGATCGCGTCTACGCTGCTGGCAGTGCTGGCAGAGGACCCGGTCGACCTGGAGCTCTTG
ACCATGCTCCTCGAGCAGGGACGCGCAGACATCAATGTCCTGAAAGGTGCCGTCATCAACAAAGCCGTCGTCCAC
CCGAACCCCGAGGTCCTCGATCTCGTCATCAACAAAGGAGAGCCGTCGACGTCGTCCATCACCCGGGCGTTGAGG
GCGCTGATGCCGCTTCCGTCGACTGAAGATAAGGCGCGGAAGCTCGAAACCCTACTGGACAGGTCGACCCGAAGG
CAAGACGTCAACTCGATGCTGGTACACGAGGTCAAGTCCATTGCTCAGAGCAGCCTGGACTCGCCGTCTCTGTCG
ACCATGAAGCATCTGCTGGAAGCCGGAGCCGATATGAACGCGCACAACGCGGCGGCCCTTTGCCATGCCGTCATT
GGGGCCAAGGCAGAAGTGGTCAGCATCATGATCCGCTGGCGACTGTCCCCGACTCCTACGGCTCTGGGCACCGCG
CTGCCACACGCTCTGCGCATCATCGACGTCGCGAAGCGGTTAGAACTGACGACCTCGTTGGTCGATGCCGGCGTC
TTCGCCGAAGAAGCCGGCCGGGCCCTGTATTACGCCACGGCCAACTTTTCAACCGACCTGTCTCTCATCGGCGTC
CTGGCCGCCGCCGCAGATCCGTCCGACGGTGAGGCGCTCGTCTTGTCCGCCTCGATGGAGTCGTCCGAGGCCATG
GACGTGATTCTCGCCAACTGCACTTCTTCCGCAGACGCTCGGAGCTCGGCCATGGACCTGGCTGTGTCGGCCAAG
AGCAAGGAAGCGCGGAGCAAGATGTGCCGAAGTCTTCTGGCCGCTGGCGTGTCGAACGAGGCTGCATCGAACGCT
CTCCTATCCGCCGCCCACGACGCCGACGTCGAGCTGTGCGACATGCTCGTGGCTCACGGCGCGGTCACGGGGAGG
CGAGGCGGCCAAGCCGTCATCGAAGCCTGCCGAAGGGGATCCGCCGAAGTCCTCAAAGTTCTCCTCAAGGTCCTT
CCCGGAACCGACGACGATGGCCAGAAGATGCTGAAGGCGGCGTTCCAGGCCGCGACAGAGGTCAGCGACTTGAAC
AGGCGAGCCGTCATCTTTGAGCAGCTCCTGAGCCAGGGCCTCAGCGGAGACCTGGTCGACGCTCAGCTGTATCCG
GCAGCAAGGTACGGCGAGGACGGCATGGCCGTCTTGAGAGTTCTCCTGGCCGCAGGGGCGAATCCCAATCACAAT
GACGGAGAGTGCGTCTTTTCCACGGCCAGCTGTGCGTTTGTGGCCCCCCTCGACCTGCTTCTTGGACTGGAGACC
GGAGAGAACCATCAGGTGAGATACTAGGAAGCCCCAAGATGTGACGAAGCCGTTCTGACATGACCATCCAGAAGA
GAGCATCACAGCCGACGCTTCTCAGGGCGCTTGACGCCTGTTGGAGCCTTCATCGCGATGCACGATATCACATCG
TGGACAGCCTGTTTAGGGCCGGCCTGTGCCCTTGCGATGAATTGCACCGGAGGCTCAACGATGCCGTCAACGAGG
AAGACGTCGAGGAGCGTCTGGTGAAGTTGCTTCTTGATCACGGCGCGTCCCCATCTTTTGATGATGGCAGGACGC
TCAAGGATGCCGCCCGGAAAATGGCATCACCGATTCTGGCCCTCGTTCTGAAGACGAATCTGTCGCAGGGGCGGA
TCACGGAGGCCTTTGGCGAGGCGTTTTCTGTGGGCAACTTTGACAATTGGTTCACTGACGCCGGGCTCGGGACTG
CGAGACTCCTGGTGGACAAGTTTAGCGACGGACAAACTCTGGGCCGAGCCCTGATGCTGGTCATGAAGAAGTCGT
CGACGGAGACTCGGGAACTGGCTGACGCCTTCTTCGACTTGCTGATGGCTCGCGGGCCAGACGTCGATTACAACG
GTGGAGAGCTTCTGCAGCAAGCCGCGTCCAAGGCGGAGCGGGCCTGGACGAGGCGGCTCTTACAATGCCATCCGT
CGACAGAAACGGTGTCCCGTGCAATTCAGCGCATCTTCGACACGGAAACCAGCCAGGAGGACGTTCTGGATCTCT
TTAGGATGTTTGGCGAATACCGCGAGTGCGAGATTGACCTCGTGACGGACCAGCAGGGCTACGAGCCGATGGTCA
AGAGAGCCATCGACCAGTACCCGAGGTCGACCATGGTGCTGAAGACGCTGCTTGACGCGGGATTCTATCACGACC
AAGCAACGCGGTGCCAGATTTACCCCGAGACGGGGGAGGAGGAGGTGTCGACGCCACTGCTCTGGGCCATTGCCC
AACCGCAGAAACGGGTCAGCACGTCGGTTATTGAGCTGCTGATCCAGCGGGGAGGTGAGTGACGAGCCCGCGTCC
CGAAACAAGGAGTCTTTCTACTGACAGGTTATGAAGCCAAGGTCAATGCCGAATCGAGCACGTCTCGGACGACTC
CGTTGATGCTGGCGACGCAGACAAGACGGCCTGACGTGGTCAAGTCATTGCTTGATCACGGCGCTGATGGGGATG
CTATCGACCGTCAGGGGCGGACGTCGCTCTGCATAGCGTCCAATGCCAGTGGAGAGGTGGCCGTACAGCTGATGA
CGATGCTGCTGGCAGCAGAACCCTCCAAGGACGACGGGTCCCTTCACAATGCGGCCCGGAATCTCGACCTGCCGG
CCGTGACGCTGCTCGTCGAGGCGGGCCACGACGCGGACTTTCCGAGCCCGCTCCACGGCGGCCGAAGCGCGCTCG
GCGAGGTCTGCCTTCACGGGTCGGACGCGGGAGAGATGACGGCATTGAGGGAACGGGCCATGCTCAAGGTCATGG
GCCTGCTGATGTCGGGCAACTCGGACCTGACGATCAAGTCCAACGGAATGTCGTTTCTGCAGCTGTGCTTCGAAG
CCACGGACGCAGTGACGACGACGCGAGCGCTGCTCAAGAGCGGCATGTGGAAGCACGTCAACAAGGCCTTTAACC
GAATCACGCTCAACGGCTACACGTACTCGCCAACCATGTACATCTCCAAGGTGCTGGGCCGGTCGAGCGTCAACA
TTCAGTTGCTGGCGGTGCTGCGGGCCAGCCGGGCGACGGACATGTTTTACGCCAGCGAGGGTCCGCAGCCGGACG
GGGCGATCGGTCTCCCGGAGGAGGTCGAAGCCGAGGACCGGGCTCGAAGGGCTCGGCTGACGCGCATCGCCATCG
AGTCGGAGGATTTCGACATGGCCATGGCTTGCAAGCGGCAGTTGGCCCGGGTCGAGCAGCAGATGGCGGCTCAGC
AGGACGAAGCCGACGACCGACGTCATCGCAACAGACACGACCACGTGCTCGAAGCCATCCAGTCTCGCGCCCTGG
CCATGGAGGCCGTAGCAACGGCAGCGCACCAGCGAAGACTCGCCGAGCAACGCGCCCTGGCAGAAGTGTCCATCG
GAAGCGCCCGTGCGGTAGCGGCGACGGAGCTCGAGGCCGAAGACGCCCGTCGGCGCAAGACGTTTGGATGGGAGC
CTCGACGGTTCGGCAGCTCGGCTGGGGGGTTTGAGGTGTCGGTCGCGGAGGAGAGGGGGGATGGCGATGGGCAGA
AGCGGTTGTTGCTGGTCGATGGATTGAGGAGGGAGTCGAGGTTGCTGGAGGAGAAGAGGGCTTCTGTTGGCTATG
TTGTGGAGTTGGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail