Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06319
Gene name
Locationscaffold_07:1936037..1941604
Strand-
Gene length (bp)5567
Transcript length (bp)5454
Coding sequence length (bp)5454
Protein length (aa) 1818

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.9E-06 1389 1458

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6201 0.5428 0.1766 0.0951 0.4154 0.0666 0.0811 0.1995 0.1715 0.0366

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2927
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7618
Ophiocordyceps australis map64 (Brazil) OphauB2|7198
Ophiocordyceps camponoti-floridani Ophcf2|06319 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3012
Ophiocordyceps kimflemingae Ophio5|955
Ophiocordyceps subramaniannii Hirsu2|4910

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06319
MSAATTSHHRHRRLAQLCEHWDIAPFETPAPLPPATPPPSFRTAADEQLAEDFLQRRAADGAHARPKGVIRQAFS
SAGLRKGKTWDPSHVLDGLTTWVANAGSPGVAEALAVKLVAAGVHLVDTQKQKGAGILNKRRTLDPHDVRVRLLR
LAVIAKNIQLAQVLLPYSDPAVLDACLPYAIRGGDGAMTELLLVQGASAAYSREGQDAFRQACTIHGHSQLVSLV
LRSVRHPEESWMSMAMCDAARAGCFDAVLLLSRSTADGNYNQAEALRSAVCSGRQDIALAIVIGSNPPQRSALNK
ALHTIQRDSSLQPATKFKLVEVLLCAGAGGVSASQALEKYYQADFLDMAALLAQYGAAAEYEDAAVLKSAVARGE
MVLVEAFLRLPGAISSATASTCVSLIAEDASFDRRHAILSLLLRQGANGQALDQMLVDAAKAGDSKSVDLLLTPF
FPAVSPRCSTNPNRHAVATVDYNSGEALCAAMLRVDLHMTRKILSRQPSPATLAAVFPLTKQLSNEDRCPMTELF
VQSSLPSACLENALVEAVNVCASERDVTLITLLLRYESEINFSHGTGLSSLIKEVDLKLLEPLLQSITPKTAAAH
LQDMMDVEDRPTRAHVAAMLLRAGADKGIDQIASTLLAVLAEDPVDLELLTMLLEQGRADINVLKGAVINKAVVH
PNPEVLDLVINKGEPSTSSITRALRALMPLPSTEDKARKLETLLDRSTRRQDVNSMLVHEVKSIAQSSLDSPSLS
TMKHLLEAGADMNAHNAAALCHAVIGAKAEVVSIMIRWRLSPTPTALGTALPHALRIIDVAKRLELTTSLVDAGV
FAEEAGRALYYATANFSTDLSLIGVLAAAADPSDGEALVLSASMESSEAMDVILANCTSSADARSSAMDLAVSAK
SKEARSKMCRSLLAAGVSNEAASNALLSAAHDADVELCDMLVAHGAVTGRRGGQAVIEACRRGSAEVLKVLLKVL
PGTDDDGQKMLKAAFQAATEVSDLNRRAVIFEQLLSQGLSGDLVDAQLYPAARYGEDGMAVLRVLLAAGANPNHN
DGECVFSTASCAFVAPLDLLLGLETGENHQKRASQPTLLRALDACWSLHRDARYHIVDSLFRAGLCPCDELHRRL
NDAVNEEDVEERLVKLLLDHGASPSFDDGRTLKDAARKMASPILALVLKTNLSQGRITEAFGEAFSVGNFDNWFT
DAGLGTARLLVDKFSDGQTLGRALMLVMKKSSTETRELADAFFDLLMARGPDVDYNGGELLQQAASKAERAWTRR
LLQCHPSTETVSRAIQRIFDTETSQEDVLDLFRMFGEYRECEIDLVTDQQGYEPMVKRAIDQYPRSTMVLKTLLD
AGFYHDQATRCQIYPETGEEEVSTPLLWAIAQPQKRVSTSVIELLIQRGAKVNAESSTSRTTPLMLATQTRRPDV
VKSLLDHGADGDAIDRQGRTSLCIASNASGEVAVQLMTMLLAAEPSKDDGSLHNAARNLDLPAVTLLVEAGHDAD
FPSPLHGGRSALGEVCLHGSDAGEMTALRERAMLKVMGLLMSGNSDLTIKSNGMSFLQLCFEATDAVTTTRALLK
SGMWKHVNKAFNRITLNGYTYSPTMYISKVLGRSSVNIQLLAVLRASRATDMFYASEGPQPDGAIGLPEEVEAED
RARRARLTRIAIESEDFDMAMACKRQLARVEQQMAAQQDEADDRRHRNRHDHVLEAIQSRALAMEAVATAAHQRR
LAEQRALAEVSIGSARAVAATELEAEDARRRKTFGWEPRRFGSSAGGFEVSVAEERGDGDGQKRLLLVDGLRRES
RLLEEKRASVGYVVELD*
Coding >Ophcf2|06319
ATGTCGGCCGCGACGACGTCTCATCACCGCCATCGACGCCTCGCCCAGCTGTGTGAGCACTGGGACATTGCGCCT
TTCGAGACGCCGGCTCCTCTACCGCCTGCTACGCCGCCGCCTTCGTTTCGCACCGCGGCAGATGAGCAGCTGGCG
GAGGATTTCCTGCAGCGACGCGCCGCCGATGGCGCTCATGCTCGTCCCAAGGGTGTCATCCGCCAGGCCTTTTCC
TCGGCTGGTCTCCGGAAGGGGAAGACGTGGGATCCCAGCCATGTGCTGGACGGTCTGACGACTTGGGTGGCCAAT
GCTGGCTCTCCGGGTGTTGCTGAGGCTCTGGCCGTCAAGCTGGTCGCTGCTGGTGTTCATCTGGTCGACACGCAG
AAGCAAAAGGGTGCCGGAATTCTCAATAAGCGTCGGACCCTCGATCCTCACGATGTCCGTGTTCGGCTGCTTCGT
CTCGCCGTCATCGCCAAGAACATTCAGCTGGCGCAGGTTCTGCTACCGTACTCGGATCCCGCTGTTCTGGACGCC
TGCTTGCCGTACGCCATCCGCGGCGGTGACGGCGCCATGACGGAGCTGTTGCTCGTTCAGGGCGCCAGTGCTGCT
TATAGCCGCGAGGGCCAGGATGCCTTTCGCCAGGCTTGCACTATTCACGGCCACTCACAGCTCGTCAGCCTCGTC
CTCCGCTCTGTGCGTCATCCGGAGGAGTCGTGGATGTCCATGGCCATGTGCGACGCCGCCCGCGCCGGTTGCTTC
GACGCCGTCTTGCTTCTCAGCCGCTCCACTGCCGACGGAAACTACAACCAGGCCGAGGCGTTGCGATCTGCGGTC
TGCTCGGGAAGACAAGACATTGCCCTGGCCATCGTCATCGGGAGCAATCCGCCTCAGAGATCAGCTCTCAACAAA
GCTCTCCACACCATCCAACGCGACTCTTCTCTCCAGCCGGCCACCAAGTTCAAGCTCGTCGAAGTCCTCCTCTGC
GCTGGAGCCGGCGGCGTCAGTGCCTCGCAGGCGCTCGAAAAGTATTATCAGGCCGACTTTCTCGACATGGCAGCC
TTGCTGGCCCAGTACGGTGCGGCCGCCGAGTATGAGGACGCGGCCGTACTCAAGTCGGCCGTTGCTCGCGGAGAG
ATGGTCCTCGTCGAGGCTTTCCTCCGTCTGCCTGGTGCCATCAGCTCAGCTACAGCGTCGACTTGCGTGTCTCTG
ATAGCAGAAGATGCCTCTTTCGACCGGCGCCATGCCATTCTCAGCCTCCTGCTGCGGCAAGGTGCCAATGGCCAG
GCTCTCGATCAGATGCTTGTCGACGCAGCAAAGGCAGGCGACTCCAAGTCGGTCGACCTGCTGCTCACCCCCTTC
TTCCCCGCCGTTTCTCCTCGTTGCTCGACGAATCCCAACAGGCACGCGGTAGCGACGGTCGACTACAACTCGGGC
GAAGCTCTCTGCGCCGCTATGCTTCGCGTCGATCTGCACATGACGCGCAAGATTCTGTCCAGACAGCCCTCTCCA
GCGACCCTGGCGGCTGTCTTTCCGCTGACGAAACAGTTGTCCAACGAGGACAGGTGTCCGATGACGGAACTGTTC
GTCCAGAGCTCGCTGCCCAGTGCGTGCCTCGAGAATGCCCTAGTCGAGGCCGTCAACGTGTGTGCTTCCGAAAGA
GACGTTACCCTCATCACCCTGCTTTTGAGATATGAATCCGAGATCAACTTCAGCCACGGGACTGGCCTGTCCTCT
CTCATCAAAGAGGTCGATCTGAAGCTGCTGGAACCCTTGCTGCAGAGCATCACACCCAAGACGGCAGCAGCTCAT
CTACAGGACATGATGGACGTTGAGGATCGCCCGACGCGTGCTCACGTGGCGGCCATGCTGCTTCGTGCTGGAGCC
GACAAGGGCATCGATCAGATCGCGTCTACGCTGCTGGCAGTGCTGGCAGAGGACCCGGTCGACCTGGAGCTCTTG
ACCATGCTCCTCGAGCAGGGACGCGCAGACATCAATGTCCTGAAAGGTGCCGTCATCAACAAAGCCGTCGTCCAC
CCGAACCCCGAGGTCCTCGATCTCGTCATCAACAAAGGAGAGCCGTCGACGTCGTCCATCACCCGGGCGTTGAGG
GCGCTGATGCCGCTTCCGTCGACTGAAGATAAGGCGCGGAAGCTCGAAACCCTACTGGACAGGTCGACCCGAAGG
CAAGACGTCAACTCGATGCTGGTACACGAGGTCAAGTCCATTGCTCAGAGCAGCCTGGACTCGCCGTCTCTGTCG
ACCATGAAGCATCTGCTGGAAGCCGGAGCCGATATGAACGCGCACAACGCGGCGGCCCTTTGCCATGCCGTCATT
GGGGCCAAGGCAGAAGTGGTCAGCATCATGATCCGCTGGCGACTGTCCCCGACTCCTACGGCTCTGGGCACCGCG
CTGCCACACGCTCTGCGCATCATCGACGTCGCGAAGCGGTTAGAACTGACGACCTCGTTGGTCGATGCCGGCGTC
TTCGCCGAAGAAGCCGGCCGGGCCCTGTATTACGCCACGGCCAACTTTTCAACCGACCTGTCTCTCATCGGCGTC
CTGGCCGCCGCCGCAGATCCGTCCGACGGTGAGGCGCTCGTCTTGTCCGCCTCGATGGAGTCGTCCGAGGCCATG
GACGTGATTCTCGCCAACTGCACTTCTTCCGCAGACGCTCGGAGCTCGGCCATGGACCTGGCTGTGTCGGCCAAG
AGCAAGGAAGCGCGGAGCAAGATGTGCCGAAGTCTTCTGGCCGCTGGCGTGTCGAACGAGGCTGCATCGAACGCT
CTCCTATCCGCCGCCCACGACGCCGACGTCGAGCTGTGCGACATGCTCGTGGCTCACGGCGCGGTCACGGGGAGG
CGAGGCGGCCAAGCCGTCATCGAAGCCTGCCGAAGGGGATCCGCCGAAGTCCTCAAAGTTCTCCTCAAGGTCCTT
CCCGGAACCGACGACGATGGCCAGAAGATGCTGAAGGCGGCGTTCCAGGCCGCGACAGAGGTCAGCGACTTGAAC
AGGCGAGCCGTCATCTTTGAGCAGCTCCTGAGCCAGGGCCTCAGCGGAGACCTGGTCGACGCTCAGCTGTATCCG
GCAGCAAGGTACGGCGAGGACGGCATGGCCGTCTTGAGAGTTCTCCTGGCCGCAGGGGCGAATCCCAATCACAAT
GACGGAGAGTGCGTCTTTTCCACGGCCAGCTGTGCGTTTGTGGCCCCCCTCGACCTGCTTCTTGGACTGGAGACC
GGAGAGAACCATCAGAAGAGAGCATCACAGCCGACGCTTCTCAGGGCGCTTGACGCCTGTTGGAGCCTTCATCGC
GATGCACGATATCACATCGTGGACAGCCTGTTTAGGGCCGGCCTGTGCCCTTGCGATGAATTGCACCGGAGGCTC
AACGATGCCGTCAACGAGGAAGACGTCGAGGAGCGTCTGGTGAAGTTGCTTCTTGATCACGGCGCGTCCCCATCT
TTTGATGATGGCAGGACGCTCAAGGATGCCGCCCGGAAAATGGCATCACCGATTCTGGCCCTCGTTCTGAAGACG
AATCTGTCGCAGGGGCGGATCACGGAGGCCTTTGGCGAGGCGTTTTCTGTGGGCAACTTTGACAATTGGTTCACT
GACGCCGGGCTCGGGACTGCGAGACTCCTGGTGGACAAGTTTAGCGACGGACAAACTCTGGGCCGAGCCCTGATG
CTGGTCATGAAGAAGTCGTCGACGGAGACTCGGGAACTGGCTGACGCCTTCTTCGACTTGCTGATGGCTCGCGGG
CCAGACGTCGATTACAACGGTGGAGAGCTTCTGCAGCAAGCCGCGTCCAAGGCGGAGCGGGCCTGGACGAGGCGG
CTCTTACAATGCCATCCGTCGACAGAAACGGTGTCCCGTGCAATTCAGCGCATCTTCGACACGGAAACCAGCCAG
GAGGACGTTCTGGATCTCTTTAGGATGTTTGGCGAATACCGCGAGTGCGAGATTGACCTCGTGACGGACCAGCAG
GGCTACGAGCCGATGGTCAAGAGAGCCATCGACCAGTACCCGAGGTCGACCATGGTGCTGAAGACGCTGCTTGAC
GCGGGATTCTATCACGACCAAGCAACGCGGTGCCAGATTTACCCCGAGACGGGGGAGGAGGAGGTGTCGACGCCA
CTGCTCTGGGCCATTGCCCAACCGCAGAAACGGGTCAGCACGTCGGTTATTGAGCTGCTGATCCAGCGGGGAGCC
AAGGTCAATGCCGAATCGAGCACGTCTCGGACGACTCCGTTGATGCTGGCGACGCAGACAAGACGGCCTGACGTG
GTCAAGTCATTGCTTGATCACGGCGCTGATGGGGATGCTATCGACCGTCAGGGGCGGACGTCGCTCTGCATAGCG
TCCAATGCCAGTGGAGAGGTGGCCGTACAGCTGATGACGATGCTGCTGGCAGCAGAACCCTCCAAGGACGACGGG
TCCCTTCACAATGCGGCCCGGAATCTCGACCTGCCGGCCGTGACGCTGCTCGTCGAGGCGGGCCACGACGCGGAC
TTTCCGAGCCCGCTCCACGGCGGCCGAAGCGCGCTCGGCGAGGTCTGCCTTCACGGGTCGGACGCGGGAGAGATG
ACGGCATTGAGGGAACGGGCCATGCTCAAGGTCATGGGCCTGCTGATGTCGGGCAACTCGGACCTGACGATCAAG
TCCAACGGAATGTCGTTTCTGCAGCTGTGCTTCGAAGCCACGGACGCAGTGACGACGACGCGAGCGCTGCTCAAG
AGCGGCATGTGGAAGCACGTCAACAAGGCCTTTAACCGAATCACGCTCAACGGCTACACGTACTCGCCAACCATG
TACATCTCCAAGGTGCTGGGCCGGTCGAGCGTCAACATTCAGTTGCTGGCGGTGCTGCGGGCCAGCCGGGCGACG
GACATGTTTTACGCCAGCGAGGGTCCGCAGCCGGACGGGGCGATCGGTCTCCCGGAGGAGGTCGAAGCCGAGGAC
CGGGCTCGAAGGGCTCGGCTGACGCGCATCGCCATCGAGTCGGAGGATTTCGACATGGCCATGGCTTGCAAGCGG
CAGTTGGCCCGGGTCGAGCAGCAGATGGCGGCTCAGCAGGACGAAGCCGACGACCGACGTCATCGCAACAGACAC
GACCACGTGCTCGAAGCCATCCAGTCTCGCGCCCTGGCCATGGAGGCCGTAGCAACGGCAGCGCACCAGCGAAGA
CTCGCCGAGCAACGCGCCCTGGCAGAAGTGTCCATCGGAAGCGCCCGTGCGGTAGCGGCGACGGAGCTCGAGGCC
GAAGACGCCCGTCGGCGCAAGACGTTTGGATGGGAGCCTCGACGGTTCGGCAGCTCGGCTGGGGGGTTTGAGGTG
TCGGTCGCGGAGGAGAGGGGGGATGGCGATGGGCAGAAGCGGTTGTTGCTGGTCGATGGATTGAGGAGGGAGTCG
AGGTTGCTGGAGGAGAAGAGGGCTTCTGTTGGCTATGTTGTGGAGTTGGATTAA
Transcript >Ophcf2|06319
ATGTCGGCCGCGACGACGTCTCATCACCGCCATCGACGCCTCGCCCAGCTGTGTGAGCACTGGGACATTGCGCCT
TTCGAGACGCCGGCTCCTCTACCGCCTGCTACGCCGCCGCCTTCGTTTCGCACCGCGGCAGATGAGCAGCTGGCG
GAGGATTTCCTGCAGCGACGCGCCGCCGATGGCGCTCATGCTCGTCCCAAGGGTGTCATCCGCCAGGCCTTTTCC
TCGGCTGGTCTCCGGAAGGGGAAGACGTGGGATCCCAGCCATGTGCTGGACGGTCTGACGACTTGGGTGGCCAAT
GCTGGCTCTCCGGGTGTTGCTGAGGCTCTGGCCGTCAAGCTGGTCGCTGCTGGTGTTCATCTGGTCGACACGCAG
AAGCAAAAGGGTGCCGGAATTCTCAATAAGCGTCGGACCCTCGATCCTCACGATGTCCGTGTTCGGCTGCTTCGT
CTCGCCGTCATCGCCAAGAACATTCAGCTGGCGCAGGTTCTGCTACCGTACTCGGATCCCGCTGTTCTGGACGCC
TGCTTGCCGTACGCCATCCGCGGCGGTGACGGCGCCATGACGGAGCTGTTGCTCGTTCAGGGCGCCAGTGCTGCT
TATAGCCGCGAGGGCCAGGATGCCTTTCGCCAGGCTTGCACTATTCACGGCCACTCACAGCTCGTCAGCCTCGTC
CTCCGCTCTGTGCGTCATCCGGAGGAGTCGTGGATGTCCATGGCCATGTGCGACGCCGCCCGCGCCGGTTGCTTC
GACGCCGTCTTGCTTCTCAGCCGCTCCACTGCCGACGGAAACTACAACCAGGCCGAGGCGTTGCGATCTGCGGTC
TGCTCGGGAAGACAAGACATTGCCCTGGCCATCGTCATCGGGAGCAATCCGCCTCAGAGATCAGCTCTCAACAAA
GCTCTCCACACCATCCAACGCGACTCTTCTCTCCAGCCGGCCACCAAGTTCAAGCTCGTCGAAGTCCTCCTCTGC
GCTGGAGCCGGCGGCGTCAGTGCCTCGCAGGCGCTCGAAAAGTATTATCAGGCCGACTTTCTCGACATGGCAGCC
TTGCTGGCCCAGTACGGTGCGGCCGCCGAGTATGAGGACGCGGCCGTACTCAAGTCGGCCGTTGCTCGCGGAGAG
ATGGTCCTCGTCGAGGCTTTCCTCCGTCTGCCTGGTGCCATCAGCTCAGCTACAGCGTCGACTTGCGTGTCTCTG
ATAGCAGAAGATGCCTCTTTCGACCGGCGCCATGCCATTCTCAGCCTCCTGCTGCGGCAAGGTGCCAATGGCCAG
GCTCTCGATCAGATGCTTGTCGACGCAGCAAAGGCAGGCGACTCCAAGTCGGTCGACCTGCTGCTCACCCCCTTC
TTCCCCGCCGTTTCTCCTCGTTGCTCGACGAATCCCAACAGGCACGCGGTAGCGACGGTCGACTACAACTCGGGC
GAAGCTCTCTGCGCCGCTATGCTTCGCGTCGATCTGCACATGACGCGCAAGATTCTGTCCAGACAGCCCTCTCCA
GCGACCCTGGCGGCTGTCTTTCCGCTGACGAAACAGTTGTCCAACGAGGACAGGTGTCCGATGACGGAACTGTTC
GTCCAGAGCTCGCTGCCCAGTGCGTGCCTCGAGAATGCCCTAGTCGAGGCCGTCAACGTGTGTGCTTCCGAAAGA
GACGTTACCCTCATCACCCTGCTTTTGAGATATGAATCCGAGATCAACTTCAGCCACGGGACTGGCCTGTCCTCT
CTCATCAAAGAGGTCGATCTGAAGCTGCTGGAACCCTTGCTGCAGAGCATCACACCCAAGACGGCAGCAGCTCAT
CTACAGGACATGATGGACGTTGAGGATCGCCCGACGCGTGCTCACGTGGCGGCCATGCTGCTTCGTGCTGGAGCC
GACAAGGGCATCGATCAGATCGCGTCTACGCTGCTGGCAGTGCTGGCAGAGGACCCGGTCGACCTGGAGCTCTTG
ACCATGCTCCTCGAGCAGGGACGCGCAGACATCAATGTCCTGAAAGGTGCCGTCATCAACAAAGCCGTCGTCCAC
CCGAACCCCGAGGTCCTCGATCTCGTCATCAACAAAGGAGAGCCGTCGACGTCGTCCATCACCCGGGCGTTGAGG
GCGCTGATGCCGCTTCCGTCGACTGAAGATAAGGCGCGGAAGCTCGAAACCCTACTGGACAGGTCGACCCGAAGG
CAAGACGTCAACTCGATGCTGGTACACGAGGTCAAGTCCATTGCTCAGAGCAGCCTGGACTCGCCGTCTCTGTCG
ACCATGAAGCATCTGCTGGAAGCCGGAGCCGATATGAACGCGCACAACGCGGCGGCCCTTTGCCATGCCGTCATT
GGGGCCAAGGCAGAAGTGGTCAGCATCATGATCCGCTGGCGACTGTCCCCGACTCCTACGGCTCTGGGCACCGCG
CTGCCACACGCTCTGCGCATCATCGACGTCGCGAAGCGGTTAGAACTGACGACCTCGTTGGTCGATGCCGGCGTC
TTCGCCGAAGAAGCCGGCCGGGCCCTGTATTACGCCACGGCCAACTTTTCAACCGACCTGTCTCTCATCGGCGTC
CTGGCCGCCGCCGCAGATCCGTCCGACGGTGAGGCGCTCGTCTTGTCCGCCTCGATGGAGTCGTCCGAGGCCATG
GACGTGATTCTCGCCAACTGCACTTCTTCCGCAGACGCTCGGAGCTCGGCCATGGACCTGGCTGTGTCGGCCAAG
AGCAAGGAAGCGCGGAGCAAGATGTGCCGAAGTCTTCTGGCCGCTGGCGTGTCGAACGAGGCTGCATCGAACGCT
CTCCTATCCGCCGCCCACGACGCCGACGTCGAGCTGTGCGACATGCTCGTGGCTCACGGCGCGGTCACGGGGAGG
CGAGGCGGCCAAGCCGTCATCGAAGCCTGCCGAAGGGGATCCGCCGAAGTCCTCAAAGTTCTCCTCAAGGTCCTT
CCCGGAACCGACGACGATGGCCAGAAGATGCTGAAGGCGGCGTTCCAGGCCGCGACAGAGGTCAGCGACTTGAAC
AGGCGAGCCGTCATCTTTGAGCAGCTCCTGAGCCAGGGCCTCAGCGGAGACCTGGTCGACGCTCAGCTGTATCCG
GCAGCAAGGTACGGCGAGGACGGCATGGCCGTCTTGAGAGTTCTCCTGGCCGCAGGGGCGAATCCCAATCACAAT
GACGGAGAGTGCGTCTTTTCCACGGCCAGCTGTGCGTTTGTGGCCCCCCTCGACCTGCTTCTTGGACTGGAGACC
GGAGAGAACCATCAGAAGAGAGCATCACAGCCGACGCTTCTCAGGGCGCTTGACGCCTGTTGGAGCCTTCATCGC
GATGCACGATATCACATCGTGGACAGCCTGTTTAGGGCCGGCCTGTGCCCTTGCGATGAATTGCACCGGAGGCTC
AACGATGCCGTCAACGAGGAAGACGTCGAGGAGCGTCTGGTGAAGTTGCTTCTTGATCACGGCGCGTCCCCATCT
TTTGATGATGGCAGGACGCTCAAGGATGCCGCCCGGAAAATGGCATCACCGATTCTGGCCCTCGTTCTGAAGACG
AATCTGTCGCAGGGGCGGATCACGGAGGCCTTTGGCGAGGCGTTTTCTGTGGGCAACTTTGACAATTGGTTCACT
GACGCCGGGCTCGGGACTGCGAGACTCCTGGTGGACAAGTTTAGCGACGGACAAACTCTGGGCCGAGCCCTGATG
CTGGTCATGAAGAAGTCGTCGACGGAGACTCGGGAACTGGCTGACGCCTTCTTCGACTTGCTGATGGCTCGCGGG
CCAGACGTCGATTACAACGGTGGAGAGCTTCTGCAGCAAGCCGCGTCCAAGGCGGAGCGGGCCTGGACGAGGCGG
CTCTTACAATGCCATCCGTCGACAGAAACGGTGTCCCGTGCAATTCAGCGCATCTTCGACACGGAAACCAGCCAG
GAGGACGTTCTGGATCTCTTTAGGATGTTTGGCGAATACCGCGAGTGCGAGATTGACCTCGTGACGGACCAGCAG
GGCTACGAGCCGATGGTCAAGAGAGCCATCGACCAGTACCCGAGGTCGACCATGGTGCTGAAGACGCTGCTTGAC
GCGGGATTCTATCACGACCAAGCAACGCGGTGCCAGATTTACCCCGAGACGGGGGAGGAGGAGGTGTCGACGCCA
CTGCTCTGGGCCATTGCCCAACCGCAGAAACGGGTCAGCACGTCGGTTATTGAGCTGCTGATCCAGCGGGGAGCC
AAGGTCAATGCCGAATCGAGCACGTCTCGGACGACTCCGTTGATGCTGGCGACGCAGACAAGACGGCCTGACGTG
GTCAAGTCATTGCTTGATCACGGCGCTGATGGGGATGCTATCGACCGTCAGGGGCGGACGTCGCTCTGCATAGCG
TCCAATGCCAGTGGAGAGGTGGCCGTACAGCTGATGACGATGCTGCTGGCAGCAGAACCCTCCAAGGACGACGGG
TCCCTTCACAATGCGGCCCGGAATCTCGACCTGCCGGCCGTGACGCTGCTCGTCGAGGCGGGCCACGACGCGGAC
TTTCCGAGCCCGCTCCACGGCGGCCGAAGCGCGCTCGGCGAGGTCTGCCTTCACGGGTCGGACGCGGGAGAGATG
ACGGCATTGAGGGAACGGGCCATGCTCAAGGTCATGGGCCTGCTGATGTCGGGCAACTCGGACCTGACGATCAAG
TCCAACGGAATGTCGTTTCTGCAGCTGTGCTTCGAAGCCACGGACGCAGTGACGACGACGCGAGCGCTGCTCAAG
AGCGGCATGTGGAAGCACGTCAACAAGGCCTTTAACCGAATCACGCTCAACGGCTACACGTACTCGCCAACCATG
TACATCTCCAAGGTGCTGGGCCGGTCGAGCGTCAACATTCAGTTGCTGGCGGTGCTGCGGGCCAGCCGGGCGACG
GACATGTTTTACGCCAGCGAGGGTCCGCAGCCGGACGGGGCGATCGGTCTCCCGGAGGAGGTCGAAGCCGAGGAC
CGGGCTCGAAGGGCTCGGCTGACGCGCATCGCCATCGAGTCGGAGGATTTCGACATGGCCATGGCTTGCAAGCGG
CAGTTGGCCCGGGTCGAGCAGCAGATGGCGGCTCAGCAGGACGAAGCCGACGACCGACGTCATCGCAACAGACAC
GACCACGTGCTCGAAGCCATCCAGTCTCGCGCCCTGGCCATGGAGGCCGTAGCAACGGCAGCGCACCAGCGAAGA
CTCGCCGAGCAACGCGCCCTGGCAGAAGTGTCCATCGGAAGCGCCCGTGCGGTAGCGGCGACGGAGCTCGAGGCC
GAAGACGCCCGTCGGCGCAAGACGTTTGGATGGGAGCCTCGACGGTTCGGCAGCTCGGCTGGGGGGTTTGAGGTG
TCGGTCGCGGAGGAGAGGGGGGATGGCGATGGGCAGAAGCGGTTGTTGCTGGTCGATGGATTGAGGAGGGAGTCG
AGGTTGCTGGAGGAGAAGAGGGCTTCTGTTGGCTATGTTGTGGAGTTGGATTAA
Gene >Ophcf2|06319
ATGTCGGCCGCGACGACGTCTCATCACCGCCATCGACGCCTCGCCCAGCTGTGTGAGCACTGGGACATTGCGCCT
TTCGAGACGCCGGCTCCTCTACCGCCTGCTACGCCGCCGCCTTCGTTTCGCACCGCGGCAGATGAGCAGCTGGCG
GAGGATTTCCTGCAGCGACGCGCCGCCGATGGCGCTCATGCTCGTCCCAAGGGTGTCATCCGCCAGGCCTTTTCC
TCGGCTGGTCTCCGGAAGGGGAAGACGTGGGATCCCAGCCATGTGCTGGACGGTCTGACGACTTGGGTGGCCAAT
GCTGGCTCTCCGGGTGTTGCTGAGGCTCTGGCCGTCAAGCTGGTCGCTGCTGGTGTTCATCTGGTCGACACGCAG
AAGCAAAAGGGTGCCGGAATTCTCAATAAGCGTCGGACCCTCGATCCTCACGATGTCCGTGTTCGGCTGCTTCGT
CTCGCCGTCATCGCCAAGAACATTCAGCTGGCGCAGGTTCTGCTACCGTACTCGGATCCCGCTGTTCTGGACGCC
TGCTTGCCGTACGCCATCCGCGGCGGTGACGGCGCCATGACGGAGCTGTTGCTCGTTCAGGGCGCCAGTGCTGCT
TATAGCCGCGAGGGCCAGGATGCCTTTCGCCAGGCTTGCACTATTCACGGCCACTCACAGCTCGTCAGCCTCGTC
CTCCGCTCTGTGCGTCATCCGGAGGAGTCGTGGATGTCCATGGCCATGTGCGACGCCGCCCGCGCCGGTTGCTTC
GACGCCGTCTTGCTTCTCAGCCGCTCCACTGCCGACGGAAACTACAACCAGGCCGAGGCGTTGCGATCTGCGGTC
TGCTCGGGAAGACAAGACATTGCCCTGGCCATCGTCATCGGGAGCAATCCGCCTCAGAGATCAGCTCTCAACAAA
GCTCTCCACACCATCCAACGCGACTCTTCTCTCCAGCCGGCCACCAAGTTCAAGCTCGTCGAAGTCCTCCTCTGC
GCTGGAGCCGGCGGCGTCAGTGCCTCGCAGGCGCTCGAAAAGTATTATCAGGCCGACTTTCTCGACATGGCAGCC
TTGCTGGCCCAGTACGGTGCGGCCGCCGAGTATGAGGACGCGGCCGTACTCAAGTCGGCCGTTGCTCGCGGAGAG
ATGGTCCTCGTCGAGGCTTTCCTCCGTCTGCCTGGTGCCATCAGCTCAGCTACAGCGTCGACTTGCGTGTCTCTG
ATAGCAGAAGATGCCTCTTTCGACCGGCGCCATGCCATTCTCAGCCTCCTGCTGCGGCAAGGTGCCAATGGCCAG
GCTCTCGATCAGATGCTTGTCGACGCAGCAAAGGCAGGCGACTCCAAGTCGGTCGACCTGCTGCTCACCCCCTTC
TTCCCCGCCGTTTCTCCTCGTTGCTCGACGAATCCCAACAGGCACGCGGTAGCGACGGTCGACTACAACTCGGGC
GAAGCTCTCTGCGCCGCTATGCTTCGCGTCGATCTGCACATGACGCGCAAGATTCTGTCCAGACAGCCCTCTCCA
GCGACCCTGGCGGCTGTCTTTCCGCTGACGAAACAGTTGTCCAACGAGGACAGGTGTCCGATGACGGAACTGTTC
GTCCAGAGCTCGCTGCCCAGTGCGTGCCTCGAGAATGCCCTAGTCGAGGCCGTCAACGTGTGTGCTTCCGAAAGA
GACGTTACCCTCATCACCCTGCTTTTGAGATATGAATCCGAGATCAACTTCAGCCACGGGACTGGCCTGTCCTCT
CTCATCAAAGAGGTCGATCTGAAGCTGCTGGAACCCTTGCTGCAGAGCATCACACCCAAGACGGCAGCAGCTCAT
CTACAGGACATGATGGACGTTGAGGATCGCCCGACGCGTGCTCACGTGGCGGCCATGCTGCTTCGTGCTGGAGCC
GACAAGGGCATCGATCAGATCGCGTCTACGCTGCTGGCAGTGCTGGCAGAGGACCCGGTCGACCTGGAGCTCTTG
ACCATGCTCCTCGAGCAGGGACGCGCAGACATCAATGTCCTGAAAGGTGCCGTCATCAACAAAGCCGTCGTCCAC
CCGAACCCCGAGGTCCTCGATCTCGTCATCAACAAAGGAGAGCCGTCGACGTCGTCCATCACCCGGGCGTTGAGG
GCGCTGATGCCGCTTCCGTCGACTGAAGATAAGGCGCGGAAGCTCGAAACCCTACTGGACAGGTCGACCCGAAGG
CAAGACGTCAACTCGATGCTGGTACACGAGGTCAAGTCCATTGCTCAGAGCAGCCTGGACTCGCCGTCTCTGTCG
ACCATGAAGCATCTGCTGGAAGCCGGAGCCGATATGAACGCGCACAACGCGGCGGCCCTTTGCCATGCCGTCATT
GGGGCCAAGGCAGAAGTGGTCAGCATCATGATCCGCTGGCGACTGTCCCCGACTCCTACGGCTCTGGGCACCGCG
CTGCCACACGCTCTGCGCATCATCGACGTCGCGAAGCGGTTAGAACTGACGACCTCGTTGGTCGATGCCGGCGTC
TTCGCCGAAGAAGCCGGCCGGGCCCTGTATTACGCCACGGCCAACTTTTCAACCGACCTGTCTCTCATCGGCGTC
CTGGCCGCCGCCGCAGATCCGTCCGACGGTGAGGCGCTCGTCTTGTCCGCCTCGATGGAGTCGTCCGAGGCCATG
GACGTGATTCTCGCCAACTGCACTTCTTCCGCAGACGCTCGGAGCTCGGCCATGGACCTGGCTGTGTCGGCCAAG
AGCAAGGAAGCGCGGAGCAAGATGTGCCGAAGTCTTCTGGCCGCTGGCGTGTCGAACGAGGCTGCATCGAACGCT
CTCCTATCCGCCGCCCACGACGCCGACGTCGAGCTGTGCGACATGCTCGTGGCTCACGGCGCGGTCACGGGGAGG
CGAGGCGGCCAAGCCGTCATCGAAGCCTGCCGAAGGGGATCCGCCGAAGTCCTCAAAGTTCTCCTCAAGGTCCTT
CCCGGAACCGACGACGATGGCCAGAAGATGCTGAAGGCGGCGTTCCAGGCCGCGACAGAGGTCAGCGACTTGAAC
AGGCGAGCCGTCATCTTTGAGCAGCTCCTGAGCCAGGGCCTCAGCGGAGACCTGGTCGACGCTCAGCTGTATCCG
GCAGCAAGGTACGGCGAGGACGGCATGGCCGTCTTGAGAGTTCTCCTGGCCGCAGGGGCGAATCCCAATCACAAT
GACGGAGAGTGCGTCTTTTCCACGGCCAGCTGTGCGTTTGTGGCCCCCCTCGACCTGCTTCTTGGACTGGAGACC
GGAGAGAACCATCAGGTGAGATACTAGGAAGCCCCAAGATGTGACGAAGCCGTTCTGACATGACCATCCAGAAGA
GAGCATCACAGCCGACGCTTCTCAGGGCGCTTGACGCCTGTTGGAGCCTTCATCGCGATGCACGATATCACATCG
TGGACAGCCTGTTTAGGGCCGGCCTGTGCCCTTGCGATGAATTGCACCGGAGGCTCAACGATGCCGTCAACGAGG
AAGACGTCGAGGAGCGTCTGGTGAAGTTGCTTCTTGATCACGGCGCGTCCCCATCTTTTGATGATGGCAGGACGC
TCAAGGATGCCGCCCGGAAAATGGCATCACCGATTCTGGCCCTCGTTCTGAAGACGAATCTGTCGCAGGGGCGGA
TCACGGAGGCCTTTGGCGAGGCGTTTTCTGTGGGCAACTTTGACAATTGGTTCACTGACGCCGGGCTCGGGACTG
CGAGACTCCTGGTGGACAAGTTTAGCGACGGACAAACTCTGGGCCGAGCCCTGATGCTGGTCATGAAGAAGTCGT
CGACGGAGACTCGGGAACTGGCTGACGCCTTCTTCGACTTGCTGATGGCTCGCGGGCCAGACGTCGATTACAACG
GTGGAGAGCTTCTGCAGCAAGCCGCGTCCAAGGCGGAGCGGGCCTGGACGAGGCGGCTCTTACAATGCCATCCGT
CGACAGAAACGGTGTCCCGTGCAATTCAGCGCATCTTCGACACGGAAACCAGCCAGGAGGACGTTCTGGATCTCT
TTAGGATGTTTGGCGAATACCGCGAGTGCGAGATTGACCTCGTGACGGACCAGCAGGGCTACGAGCCGATGGTCA
AGAGAGCCATCGACCAGTACCCGAGGTCGACCATGGTGCTGAAGACGCTGCTTGACGCGGGATTCTATCACGACC
AAGCAACGCGGTGCCAGATTTACCCCGAGACGGGGGAGGAGGAGGTGTCGACGCCACTGCTCTGGGCCATTGCCC
AACCGCAGAAACGGGTCAGCACGTCGGTTATTGAGCTGCTGATCCAGCGGGGAGGTGAGTGACGAGCCCGCGTCC
CGAAACAAGGAGTCTTTCTACTGACAGGTTATGAAGCCAAGGTCAATGCCGAATCGAGCACGTCTCGGACGACTC
CGTTGATGCTGGCGACGCAGACAAGACGGCCTGACGTGGTCAAGTCATTGCTTGATCACGGCGCTGATGGGGATG
CTATCGACCGTCAGGGGCGGACGTCGCTCTGCATAGCGTCCAATGCCAGTGGAGAGGTGGCCGTACAGCTGATGA
CGATGCTGCTGGCAGCAGAACCCTCCAAGGACGACGGGTCCCTTCACAATGCGGCCCGGAATCTCGACCTGCCGG
CCGTGACGCTGCTCGTCGAGGCGGGCCACGACGCGGACTTTCCGAGCCCGCTCCACGGCGGCCGAAGCGCGCTCG
GCGAGGTCTGCCTTCACGGGTCGGACGCGGGAGAGATGACGGCATTGAGGGAACGGGCCATGCTCAAGGTCATGG
GCCTGCTGATGTCGGGCAACTCGGACCTGACGATCAAGTCCAACGGAATGTCGTTTCTGCAGCTGTGCTTCGAAG
CCACGGACGCAGTGACGACGACGCGAGCGCTGCTCAAGAGCGGCATGTGGAAGCACGTCAACAAGGCCTTTAACC
GAATCACGCTCAACGGCTACACGTACTCGCCAACCATGTACATCTCCAAGGTGCTGGGCCGGTCGAGCGTCAACA
TTCAGTTGCTGGCGGTGCTGCGGGCCAGCCGGGCGACGGACATGTTTTACGCCAGCGAGGGTCCGCAGCCGGACG
GGGCGATCGGTCTCCCGGAGGAGGTCGAAGCCGAGGACCGGGCTCGAAGGGCTCGGCTGACGCGCATCGCCATCG
AGTCGGAGGATTTCGACATGGCCATGGCTTGCAAGCGGCAGTTGGCCCGGGTCGAGCAGCAGATGGCGGCTCAGC
AGGACGAAGCCGACGACCGACGTCATCGCAACAGACACGACCACGTGCTCGAAGCCATCCAGTCTCGCGCCCTGG
CCATGGAGGCCGTAGCAACGGCAGCGCACCAGCGAAGACTCGCCGAGCAACGCGCCCTGGCAGAAGTGTCCATCG
GAAGCGCCCGTGCGGTAGCGGCGACGGAGCTCGAGGCCGAAGACGCCCGTCGGCGCAAGACGTTTGGATGGGAGC
CTCGACGGTTCGGCAGCTCGGCTGGGGGGTTTGAGGTGTCGGTCGCGGAGGAGAGGGGGGATGGCGATGGGCAGA
AGCGGTTGTTGCTGGTCGATGGATTGAGGAGGGAGTCGAGGTTGCTGGAGGAGAAGAGGGCTTCTGTTGGCTATG
TTGTGGAGTTGGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail