Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06314
Gene name
Locationscaffold_07:1922634..1923884
Strand+
Gene length (bp)1250
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02833 DHHA2 DHHA2 domain 4.8E-34 243 391
PF01368 DHH DHH family 1.2E-10 30 176

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0016462 pyrophosphatase activity Yes
GO:0005575 cellular_component No
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0016787 hydrolase activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5998 0.7195 0.1449 0.0186 0.259 0.0079 0.0242 0.1787 0.0567 0.0057

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1049
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2794
Ophiocordyceps australis 1348a (Ghana) OphauG2|4963
Ophiocordyceps australis map64 (Brazil) OphauB2|7204
Ophiocordyceps camponoti-floridani Ophcf2|06314 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|414
Ophiocordyceps kimflemingae Ophio5|950
Ophiocordyceps subramaniannii Hirsu2|9833

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06314
MFRSSLKSFLATAKNTLNRPASQQPTPLTLVVGNESADLDSLCCAIVYAYLRSQPRNDADRQQRVPPTGLHVPLS
HLPRADLGLRPELTAVLAHAGLAPADLITLSELPDLSSTDESTRWILVDHNALTGPLARFAHRVVGCVDHHDDEG
TVPSNASPRVIEPCGSCMSLVVDETRRDWDALTGRNAHDDDALAKLCLAPILVDTINLSPIAKKVRPKDTRAVDY
LEAKLSRKGTYSRHVFYDEISAAKDDLSRLSMRDLLRKDYKQWRENHLVLGISCSVADLSALIEKATGPKHLLDS
LSDWSDERGLDVAAIMTASTTDGSFHRHLLVWGRSPRGDAAVARFVEHARQPLRLESWRRGELDDGESRFAWHQR
ELAASRKRVGPLMREAMRKA*
Coding >Ophcf2|06314
ATGTTCCGAAGCTCCCTAAAAAGCTTCCTGGCCACGGCCAAGAACACCCTCAACCGACCCGCGAGTCAGCAGCCG
ACGCCATTGACTCTGGTAGTGGGCAACGAGTCGGCCGACCTCGACTCCCTCTGCTGCGCCATCGTCTACGCCTAC
CTGCGCTCACAGCCGAGGAACGATGCCGATAGACAGCAGAGAGTTCCGCCTACGGGGCTTCACGTTCCGCTCTCC
CACCTTCCCCGCGCCGATCTCGGTCTTCGCCCAGAACTGACGGCTGTGTTGGCCCACGCTGGCCTCGCGCCCGCC
GATCTCATCACGCTTTCTGAGTTACCTGATCTGTCTTCGACTGACGAGTCGACGCGTTGGATATTGGTCGATCAC
AATGCGCTGACGGGTCCGCTTGCGCGCTTTGCCCATCGCGTCGTTGGCTGCGTTGACCATCACGATGATGAGGGA
ACTGTTCCTTCTAATGCTTCTCCGCGCGTCATCGAGCCTTGCGGTAGCTGCATGAGTCTCGTCGTCGATGAAACT
CGTCGGGACTGGGATGCGCTGACTGGTCGCAACGCTCACGATGATGATGCGCTGGCAAAGTTGTGTCTAGCCCCT
ATCCTCGTCGACACCATCAACCTCTCCCCCATAGCCAAAAAGGTCCGACCCAAAGACACGCGAGCCGTCGATTAC
CTCGAAGCCAAGCTCTCCCGCAAAGGTACATACTCGCGCCATGTCTTCTACGATGAGATCTCAGCCGCAAAGGAT
GATCTCTCGCGCCTCAGCATGCGCGACCTCCTGCGAAAGGACTACAAACAATGGCGCGAAAACCATCTCGTCCTC
GGCATAAGCTGCTCCGTCGCCGACCTCTCCGCCCTCATCGAAAAGGCCACCGGCCCGAAGCACCTACTCGACAGC
CTATCCGACTGGTCCGACGAGCGCGGCCTCGACGTCGCCGCCATCATGACAGCCTCCACCACCGACGGCAGCTTC
CACCGCCATCTTCTGGTATGGGGACGTAGCCCCCGGGGTGACGCTGCCGTCGCCCGCTTCGTCGAGCATGCTAGA
CAACCGCTTCGTCTCGAGTCTTGGCGTCGAGGTGAGCTTGATGATGGCGAGTCGAGATTTGCCTGGCATCAGCGT
GAGTTGGCTGCCAGTCGGAAGAGAGTTGGACCGCTGATGCGGGAGGCTATGCGCAAGGCCTGA
Transcript >Ophcf2|06314
ATGTTCCGAAGCTCCCTAAAAAGCTTCCTGGCCACGGCCAAGAACACCCTCAACCGACCCGCGAGTCAGCAGCCG
ACGCCATTGACTCTGGTAGTGGGCAACGAGTCGGCCGACCTCGACTCCCTCTGCTGCGCCATCGTCTACGCCTAC
CTGCGCTCACAGCCGAGGAACGATGCCGATAGACAGCAGAGAGTTCCGCCTACGGGGCTTCACGTTCCGCTCTCC
CACCTTCCCCGCGCCGATCTCGGTCTTCGCCCAGAACTGACGGCTGTGTTGGCCCACGCTGGCCTCGCGCCCGCC
GATCTCATCACGCTTTCTGAGTTACCTGATCTGTCTTCGACTGACGAGTCGACGCGTTGGATATTGGTCGATCAC
AATGCGCTGACGGGTCCGCTTGCGCGCTTTGCCCATCGCGTCGTTGGCTGCGTTGACCATCACGATGATGAGGGA
ACTGTTCCTTCTAATGCTTCTCCGCGCGTCATCGAGCCTTGCGGTAGCTGCATGAGTCTCGTCGTCGATGAAACT
CGTCGGGACTGGGATGCGCTGACTGGTCGCAACGCTCACGATGATGATGCGCTGGCAAAGTTGTGTCTAGCCCCT
ATCCTCGTCGACACCATCAACCTCTCCCCCATAGCCAAAAAGGTCCGACCCAAAGACACGCGAGCCGTCGATTAC
CTCGAAGCCAAGCTCTCCCGCAAAGGTACATACTCGCGCCATGTCTTCTACGATGAGATCTCAGCCGCAAAGGAT
GATCTCTCGCGCCTCAGCATGCGCGACCTCCTGCGAAAGGACTACAAACAATGGCGCGAAAACCATCTCGTCCTC
GGCATAAGCTGCTCCGTCGCCGACCTCTCCGCCCTCATCGAAAAGGCCACCGGCCCGAAGCACCTACTCGACAGC
CTATCCGACTGGTCCGACGAGCGCGGCCTCGACGTCGCCGCCATCATGACAGCCTCCACCACCGACGGCAGCTTC
CACCGCCATCTTCTGGTATGGGGACGTAGCCCCCGGGGTGACGCTGCCGTCGCCCGCTTCGTCGAGCATGCTAGA
CAACCGCTTCGTCTCGAGTCTTGGCGTCGAGGTGAGCTTGATGATGGCGAGTCGAGATTTGCCTGGCATCAGCGT
GAGTTGGCTGCCAGTCGGAAGAGAGTTGGACCGCTGATGCGGGAGGCTATGCGCAAGGCCTGA
Gene >Ophcf2|06314
ATGTTCCGAAGCTCCCTAAAAAGCTTCCTGGCCACGGCCAAGAACACCCTCAACCGACCCGCGAGTCAGCAGCCG
ACGCCATTGACTCTGGTAGTGGGCAACGAGTCGGCCGGCGAGTCGGCCCGCCACCGCCCCGGATACGACGAGCCT
CGGGCTGACCCAAGCCCCCATCAGACCTCGACTCCCTCTGCTGCGCCATCGTCTACGCCTACCTGCGCTCACAGC
CGAGGAACGATGCCGATAGACAGCAGAGAGTTCCGCCTACGGGGCTTCACGTTCCGCTCTCCCACCTTCCCCGCG
CCGATCTCGGTCTTCGCCCAGAACTGACGGCTGTGTTGGCCCACGCTGGCCTCGCGCCCGCCGATCTCATCACGC
TTTCTGAGTTACCTGATCTGTCTTCGACTGACGAGTCGACGCGTTGGATATTGGTCGATCACAATGCGCTGACGG
GTCCGCTTGCGCGCTTTGCCCATCGCGTCGTTGGCTGCGTTGACCATCACGATGATGAGGGAACTGTTCCTTCTA
ATGCTTCTCCGCGCGTCATCGAGCCTTGCGGTAGCTGCATGAGTCTCGTCGTCGATGAAACTCGTCGGGACTGGG
ATGCGCTGACTGGTCGCAACGCTCACGATGATGATGCGCTGGCAAAGTTGTGTCTAGCCCCTATCCTCGTCGACA
CCATCAACCTCTCCCCCATAGCCAAAAAGGTCCGACCCAAAGACACGCGAGCCGTCGATTACCTCGAAGCCAAGC
TCTCCCGCAAAGGTACATACTCGCGCCATGTCTTCTACGATGAGATCTCAGCCGCAAAGGATGATCTCTCGCGCC
TCAGCATGCGCGACCTCCTGCGAAAGGACTACAAACAATGGCGCGAAAACCATCTCGTCCTCGGCATAAGCTGCT
CCGTCGCCGACCTCTCCGCCCTCATCGAAAAGGCCACCGGCCCGAAGCACCTACTCGACAGCCTATCCGACTGGT
CCGACGAGCGCGGCCTCGACGTCGCCGCCATCATGACAGCCTCCACCACCGACGGCAGCTTCCACCGCCATCTTC
TGGTATGGGGACGTAGCCCCCGGGGTGACGCTGCCGTCGCCCGCTTCGTCGAGCATGCTAGACAACCGCTTCGTC
TCGAGTCTTGGCGTCGAGGTGAGCTTGATGATGGCGAGTCGAGATTTGCCTGGCATCAGCGTGAGTTGGCTGCCA
GTCGGAAGAGAGTTGGACCGCTGATGCGGGAGGCTATGCGCAAGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail