Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06313
Gene name
Locationscaffold_07:1920275..1921115
Strand-
Gene length (bp)840
Transcript length (bp)768
Coding sequence length (bp)768
Protein length (aa) 256

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00117 GATase Glutamine amidotransferase class-I 4.5E-10 67 214

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5501 0.4406 0.0202 0.0787 0.2708 0.2118 0.2203 0.1295 0.1195 0.0158

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3865
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4964
Ophiocordyceps australis map64 (Brazil) OphauB2|2805
Ophiocordyceps camponoti-floridani Ophcf2|06313 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2259
Ophiocordyceps kimflemingae Ophio5|949
Ophiocordyceps subramaniannii Hirsu2|7653

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06313
MGSPAPEPLRLAVLECDRPQPQTRHIHNSYTGVFTALLDSASKILDPPRQLDSLVSIEGYDVVNELHTYPALDEI
DAVLITGSRHTAFHEDPWIKNLVAFTKKALNSGRVRVIGVCFGHQIVGRALGSRLAQSENGWEVAVTEVDLTGKG
KDLFGLEKMRIHQMHRDIVVDFPPDAVPLGSNSFCTVQNMYSPGRYLTVQGHPEFTDDIISEILFNRHTVGIFSD
EVYEDGIRRASLPHDGVSIGRAFLKFMREG*
Coding >Ophcf2|06313
ATGGGCTCTCCAGCGCCTGAGCCCCTCCGCCTCGCCGTGCTCGAATGCGACAGGCCTCAGCCGCAGACGCGCCAC
ATCCACAACAGCTACACGGGCGTCTTCACTGCCCTTCTCGATTCTGCCAGCAAGATTCTCGATCCGCCGAGGCAA
CTCGACTCCCTCGTGTCCATCGAGGGTTACGATGTCGTCAACGAGCTGCATACGTACCCTGCTCTCGACGAGATC
GATGCCGTCCTCATCACCGGCTCGCGCCATACCGCCTTTCACGAAGATCCCTGGATTAAGAACCTGGTCGCCTTC
ACCAAAAAGGCGCTAAACAGCGGTCGGGTCCGCGTCATTGGCGTCTGCTTCGGCCACCAGATCGTCGGTCGCGCC
CTCGGGTCCCGTCTGGCGCAGAGCGAAAACGGTTGGGAGGTGGCCGTCACAGAAGTCGATCTGACGGGCAAAGGC
AAGGATCTGTTTGGTCTGGAAAAGATGCGCATTCACCAGATGCATCGCGACATCGTCGTCGACTTCCCCCCCGAC
GCCGTGCCTCTGGGCTCTAATAGCTTCTGCACCGTCCAAAATATGTACTCGCCCGGGCGCTACCTCACCGTCCAG
GGCCACCCCGAGTTTACAGACGACATCATCTCCGAGATTCTCTTCAACCGTCACACAGTCGGCATATTCAGCGAC
GAAGTTTACGAGGACGGCATACGCCGCGCATCATTGCCCCACGATGGCGTTTCAATCGGAAGGGCTTTTTTGAAG
TTTATGCGCGAAGGATGA
Transcript >Ophcf2|06313
ATGGGCTCTCCAGCGCCTGAGCCCCTCCGCCTCGCCGTGCTCGAATGCGACAGGCCTCAGCCGCAGACGCGCCAC
ATCCACAACAGCTACACGGGCGTCTTCACTGCCCTTCTCGATTCTGCCAGCAAGATTCTCGATCCGCCGAGGCAA
CTCGACTCCCTCGTGTCCATCGAGGGTTACGATGTCGTCAACGAGCTGCATACGTACCCTGCTCTCGACGAGATC
GATGCCGTCCTCATCACCGGCTCGCGCCATACCGCCTTTCACGAAGATCCCTGGATTAAGAACCTGGTCGCCTTC
ACCAAAAAGGCGCTAAACAGCGGTCGGGTCCGCGTCATTGGCGTCTGCTTCGGCCACCAGATCGTCGGTCGCGCC
CTCGGGTCCCGTCTGGCGCAGAGCGAAAACGGTTGGGAGGTGGCCGTCACAGAAGTCGATCTGACGGGCAAAGGC
AAGGATCTGTTTGGTCTGGAAAAGATGCGCATTCACCAGATGCATCGCGACATCGTCGTCGACTTCCCCCCCGAC
GCCGTGCCTCTGGGCTCTAATAGCTTCTGCACCGTCCAAAATATGTACTCGCCCGGGCGCTACCTCACCGTCCAG
GGCCACCCCGAGTTTACAGACGACATCATCTCCGAGATTCTCTTCAACCGTCACACAGTCGGCATATTCAGCGAC
GAAGTTTACGAGGACGGCATACGCCGCGCATCATTGCCCCACGATGGCGTTTCAATCGGAAGGGCTTTTTTGAAG
TTTATGCGCGAAGGATGA
Gene >Ophcf2|06313
ATGGGCTCTCCAGCGCCTGAGCCCCTCCGCCTCGCCGTGCTCGAATGCGACAGGCCTCAGCCGCAGACGCGCCAC
ATCCACAACAGCTACACGGGCGTCTTCACTGCCCTTCTCGATTCTGCCAGCAAGATTCTCGATCCGCCGAGGCAA
CTCGACTCCCTCGTGTCCATCGAGGGTTACGATGTCGTCAACGAGCTGCATACGTACCCTGCTCTCGACGAGATC
GATGCCGTCCTCATCACCGGCTCGCGCCATACCGCCTTTCACGAAGATCCCTGGATTAAGAACCTGGTCGCCTTC
ACCAAAAAGGCGCTAAACAGCGGTCGGGTCCGCGTCATTGGCGTCTGCTTCGGCCACCAGATCGTCGGTCGCGCC
CTCGGGTCCCGTCTGGCGCAGAGCGAAAACGGTTGGGAGGTGGCCGTCACAGAAGTCGATCTGACGGGCAAAGGC
AAGGATCTGTTTGGTCTGGAAAAGATGGTGCGTTCACCCAGTAGTGCTTCCCTTTCGCCGAGAGACCGGATGACA
GCGACTGACTGGATGGATAAACAGCGCATTCACCAGATGCATCGCGACATCGTCGTCGACTTCCCCCCCGACGCC
GTGCCTCTGGGCTCTAATAGCTTCTGCACCGTCCAAAATATGTACTCGCCCGGGCGCTACCTCACCGTCCAGGGC
CACCCCGAGTTTACAGACGACATCATCTCCGAGATTCTCTTCAACCGTCACACAGTCGGCATATTCAGCGACGAA
GTTTACGAGGACGGCATACGCCGCGCATCATTGCCCCACGATGGCGTTTCAATCGGAAGGGCTTTTTTGAAGTTT
ATGCGCGAAGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail