Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06312
Gene name
Locationscaffold_07:1918563..1919966
Strand+
Gene length (bp)1403
Transcript length (bp)1299
Coding sequence length (bp)1299
Protein length (aa) 433

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11710 Git3 G protein-coupled glucose receptor regulating Gpa2 6.5E-34 34 190
PF11970 GPR_Gpa2_C G protein-coupled glucose receptor regulating Gpa2 C-term 3.6E-17 281 351

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 15 33 18
2 40 62 22
3 77 99 22
4 120 142 22
5 162 184 22
6 292 314 22
7 324 346 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 10.55 4.14 16.96
Alive In ants, during behavior modification 13.53 5.54 21.51
Dead In ants, recently dead 11.32 4.49 18.14

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.366023 no
Alive Dead 0.465975 no
Dead Fungus 0.833105 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06312
MPLSSPAPLTISPQGHKLAINVTCLVLASLSVVATAWAKILIVILLQIDLFKSAILVLVPAIELVHGPVISGSTT
CHVIGCVLLITLEACNVAIVLLALHTALNVFRGEGGLYPHRRLAWAVGLVLPLALASLAFINRPAFVNTDGFCQV
PERPRWPKRVLIWLPRGLCLVIIVFTYVATFVHVQKLMRRFVAGPAQPGPRIKAVEPPPPPSLASLRLGPWQPDV
IPFRDSGIRPVLTLASVSGPPCPVVSGSHPSLLIRPDSSTAVTLSPTTFGASGIAETRDRVRRQLRLLFIYPMVY
MGLWTVPLICHITSVLDRGETVGLSLASIASLSLQGVADALVFLVVEKPWRLPRHGDASCWLVHAIQGTAVTTTT
NAGRSRDEMRFDSRVARRRREGERAAERRSKHSPGRVREWWEVGVETDVEDDGYSDT*
Coding >Ophcf2|06312
ATGCCCCTTTCAAGCCCCGCCCCCCTGACCATCAGCCCACAAGGCCACAAGCTGGCCATCAACGTGACTTGCCTC
GTCCTCGCAAGCCTAAGTGTCGTGGCCACGGCTTGGGCCAAGATCCTCATCGTGATCCTCCTCCAAATCGACCTC
TTCAAATCAGCCATCCTCGTCCTCGTCCCCGCCATAGAACTCGTCCACGGTCCCGTCATCTCAGGCTCGACAACA
TGTCACGTCATCGGTTGCGTCCTTCTCATCACTCTGGAAGCCTGCAACGTCGCCATCGTCCTCCTCGCTCTGCAC
ACGGCCCTCAACGTATTCCGAGGCGAAGGGGGACTGTACCCGCATCGACGTCTGGCTTGGGCTGTCGGCCTCGTG
CTACCTCTGGCTCTCGCTTCGCTTGCCTTCATCAATAGGCCTGCTTTTGTCAATACCGATGGCTTCTGTCAAGTT
CCTGAGAGGCCGAGGTGGCCGAAGCGGGTGCTAATATGGCTCCCTCGCGGCCTGTGTCTCGTCATCATCGTCTTC
ACTTACGTTGCCACCTTTGTACACGTTCAGAAGCTCATGAGACGCTTCGTCGCTGGGCCTGCACAGCCGGGACCT
AGGATCAAGGCAGTCGAACCGCCCCCGCCGCCTTCGCTGGCCTCGCTCCGTCTCGGTCCGTGGCAGCCGGACGTG
ATCCCGTTCCGGGACTCGGGCATCCGGCCTGTGCTGACGCTGGCTTCTGTATCGGGACCGCCTTGTCCGGTCGTA
TCTGGCTCTCATCCGTCGTTGCTGATCCGACCAGACTCGTCGACAGCCGTCACGCTCTCCCCAACGACATTCGGA
GCCTCAGGAATAGCCGAGACGCGAGACAGGGTCCGCCGCCAGCTTCGTCTGCTCTTCATCTACCCCATGGTTTAC
ATGGGCTTGTGGACCGTCCCCCTGATCTGCCACATCACGAGCGTCCTCGACCGCGGCGAAACCGTCGGCCTCAGC
CTAGCCAGCATCGCCAGTCTCAGCCTGCAGGGAGTCGCCGACGCTCTCGTGTTCCTCGTCGTGGAGAAGCCGTGG
CGTCTGCCGCGGCATGGCGACGCCTCTTGCTGGCTCGTTCACGCCATACAGGGCACCGCGGTGACGACCACCACC
AACGCTGGCCGCAGTCGCGACGAGATGCGCTTCGACAGCCGCGTCGCGAGACGTCGTCGAGAAGGAGAGCGCGCT
GCCGAGCGTCGTTCCAAGCACAGCCCCGGCCGCGTGCGCGAGTGGTGGGAGGTTGGTGTCGAGACTGATGTGGAA
GACGACGGCTACAGCGACACGTGA
Transcript >Ophcf2|06312
ATGCCCCTTTCAAGCCCCGCCCCCCTGACCATCAGCCCACAAGGCCACAAGCTGGCCATCAACGTGACTTGCCTC
GTCCTCGCAAGCCTAAGTGTCGTGGCCACGGCTTGGGCCAAGATCCTCATCGTGATCCTCCTCCAAATCGACCTC
TTCAAATCAGCCATCCTCGTCCTCGTCCCCGCCATAGAACTCGTCCACGGTCCCGTCATCTCAGGCTCGACAACA
TGTCACGTCATCGGTTGCGTCCTTCTCATCACTCTGGAAGCCTGCAACGTCGCCATCGTCCTCCTCGCTCTGCAC
ACGGCCCTCAACGTATTCCGAGGCGAAGGGGGACTGTACCCGCATCGACGTCTGGCTTGGGCTGTCGGCCTCGTG
CTACCTCTGGCTCTCGCTTCGCTTGCCTTCATCAATAGGCCTGCTTTTGTCAATACCGATGGCTTCTGTCAAGTT
CCTGAGAGGCCGAGGTGGCCGAAGCGGGTGCTAATATGGCTCCCTCGCGGCCTGTGTCTCGTCATCATCGTCTTC
ACTTACGTTGCCACCTTTGTACACGTTCAGAAGCTCATGAGACGCTTCGTCGCTGGGCCTGCACAGCCGGGACCT
AGGATCAAGGCAGTCGAACCGCCCCCGCCGCCTTCGCTGGCCTCGCTCCGTCTCGGTCCGTGGCAGCCGGACGTG
ATCCCGTTCCGGGACTCGGGCATCCGGCCTGTGCTGACGCTGGCTTCTGTATCGGGACCGCCTTGTCCGGTCGTA
TCTGGCTCTCATCCGTCGTTGCTGATCCGACCAGACTCGTCGACAGCCGTCACGCTCTCCCCAACGACATTCGGA
GCCTCAGGAATAGCCGAGACGCGAGACAGGGTCCGCCGCCAGCTTCGTCTGCTCTTCATCTACCCCATGGTTTAC
ATGGGCTTGTGGACCGTCCCCCTGATCTGCCACATCACGAGCGTCCTCGACCGCGGCGAAACCGTCGGCCTCAGC
CTAGCCAGCATCGCCAGTCTCAGCCTGCAGGGAGTCGCCGACGCTCTCGTGTTCCTCGTCGTGGAGAAGCCGTGG
CGTCTGCCGCGGCATGGCGACGCCTCTTGCTGGCTCGTTCACGCCATACAGGGCACCGCGGTGACGACCACCACC
AACGCTGGCCGCAGTCGCGACGAGATGCGCTTCGACAGCCGCGTCGCGAGACGTCGTCGAGAAGGAGAGCGCGCT
GCCGAGCGTCGTTCCAAGCACAGCCCCGGCCGCGTGCGCGAGTGGTGGGAGGTTGGTGTCGAGACTGATGTGGAA
GACGACGGCTACAGCGACACGTGA
Gene >Ophcf2|06312
ATGCCCCTTTCAAGCCCCGCCCCCCTGACCATCAGCCCACAAGGCCACAAGCTGGCCATCAACGTGACTTGCCTC
GTCCTCGCAAGCCTAAGTGTCGTGGCCACGGCTTGGGCCAAGATGTGCTTCCTTCGCGTACGGAAGAACTTTCGC
TACGAGCGCGTTTTCACCCCCCCCCTTTCCTACTCTACATGAAAACTTGATCCATCAGCTAAGAGAGAAACAGCC
TCATCGTGATCCTCCTCCAAATCGACCTCTTCAAATCAGCCATCCTCGTCCTCGTCCCCGCCATAGAACTCGTCC
ACGGTCCCGTCATCTCAGGCTCGACAACATGTCACGTCATCGGTTGCGTCCTTCTCATCACTCTGGAAGCCTGCA
ACGTCGCCATCGTCCTCCTCGCTCTGCACACGGCCCTCAACGTATTCCGAGGCGAAGGGGGACTGTACCCGCATC
GACGTCTGGCTTGGGCTGTCGGCCTCGTGCTACCTCTGGCTCTCGCTTCGCTTGCCTTCATCAATAGGCCTGCTT
TTGTCAATACCGATGGCTTCTGTCAAGTTCCTGAGAGGCCGAGGTGGCCGAAGCGGGTGCTAATATGGCTCCCTC
GCGGCCTGTGTCTCGTCATCATCGTCTTCACTTACGTTGCCACCTTTGTACACGTTCAGAAGCTCATGAGACGCT
TCGTCGCTGGGCCTGCACAGCCGGGACCTAGGATCAAGGCAGTCGAACCGCCCCCGCCGCCTTCGCTGGCCTCGC
TCCGTCTCGGTCCGTGGCAGCCGGACGTGATCCCGTTCCGGGACTCGGGCATCCGGCCTGTGCTGACGCTGGCTT
CTGTATCGGGACCGCCTTGTCCGGTCGTATCTGGCTCTCATCCGTCGTTGCTGATCCGACCAGACTCGTCGACAG
CCGTCACGCTCTCCCCAACGACATTCGGAGCCTCAGGAATAGCCGAGACGCGAGACAGGGTCCGCCGCCAGCTTC
GTCTGCTCTTCATCTACCCCATGGTTTACATGGGCTTGTGGACCGTCCCCCTGATCTGCCACATCACGAGCGTCC
TCGACCGCGGCGAAACCGTCGGCCTCAGCCTAGCCAGCATCGCCAGTCTCAGCCTGCAGGGAGTCGCCGACGCTC
TCGTGTTCCTCGTCGTGGAGAAGCCGTGGCGTCTGCCGCGGCATGGCGACGCCTCTTGCTGGCTCGTTCACGCCA
TACAGGGCACCGCGGTGACGACCACCACCAACGCTGGCCGCAGTCGCGACGAGATGCGCTTCGACAGCCGCGTCG
CGAGACGTCGTCGAGAAGGAGAGCGCGCTGCCGAGCGTCGTTCCAAGCACAGCCCCGGCCGCGTGCGCGAGTGGT
GGGAGGTTGGTGTCGAGACTGATGTGGAAGACGACGGCTACAGCGACACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail