Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06312
Gene name
Locationscaffold_07:1918563..1919966
Strand+
Gene length (bp)1403
Transcript length (bp)1299
Coding sequence length (bp)1299
Protein length (aa) 433

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11710 Git3 G protein-coupled glucose receptor regulating Gpa2 6.5E-34 34 190
PF11970 GPR_Gpa2_C G protein-coupled glucose receptor regulating Gpa2 C-term 3.6E-17 281 351

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 15 33 18
2 40 62 22
3 77 99 22
4 120 142 22
5 162 184 22
6 292 314 22
7 324 346 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06312
MPLSSPAPLTISPQGHKLAINVTCLVLASLSVVATAWAKILIVILLQIDLFKSAILVLVPAIELVHGPVISGSTT
CHVIGCVLLITLEACNVAIVLLALHTALNVFRGEGGLYPHRRLAWAVGLVLPLALASLAFINRPAFVNTDGFCQV
PERPRWPKRVLIWLPRGLCLVIIVFTYVATFVHVQKLMRRFVAGPAQPGPRIKAVEPPPPPSLASLRLGPWQPDV
IPFRDSGIRPVLTLASVSGPPCPVVSGSHPSLLIRPDSSTAVTLSPTTFGASGIAETRDRVRRQLRLLFIYPMVY
MGLWTVPLICHITSVLDRGETVGLSLASIASLSLQGVADALVFLVVEKPWRLPRHGDASCWLVHAIQGTAVTTTT
NAGRSRDEMRFDSRVARRRREGERAAERRSKHSPGRVREWWEVGVETDVEDDGYSDT*
Coding >Ophcf2|06312
ATGCCCCTTTCAAGCCCCGCCCCCCTGACCATCAGCCCACAAGGCCACAAGCTGGCCATCAACGTGACTTGCCTC
GTCCTCGCAAGCCTAAGTGTCGTGGCCACGGCTTGGGCCAAGATCCTCATCGTGATCCTCCTCCAAATCGACCTC
TTCAAATCAGCCATCCTCGTCCTCGTCCCCGCCATAGAACTCGTCCACGGTCCCGTCATCTCAGGCTCGACAACA
TGTCACGTCATCGGTTGCGTCCTTCTCATCACTCTGGAAGCCTGCAACGTCGCCATCGTCCTCCTCGCTCTGCAC
ACGGCCCTCAACGTATTCCGAGGCGAAGGGGGACTGTACCCGCATCGACGTCTGGCTTGGGCTGTCGGCCTCGTG
CTACCTCTGGCTCTCGCTTCGCTTGCCTTCATCAATAGGCCTGCTTTTGTCAATACCGATGGCTTCTGTCAAGTT
CCTGAGAGGCCGAGGTGGCCGAAGCGGGTGCTAATATGGCTCCCTCGCGGCCTGTGTCTCGTCATCATCGTCTTC
ACTTACGTTGCCACCTTTGTACACGTTCAGAAGCTCATGAGACGCTTCGTCGCTGGGCCTGCACAGCCGGGACCT
AGGATCAAGGCAGTCGAACCGCCCCCGCCGCCTTCGCTGGCCTCGCTCCGTCTCGGTCCGTGGCAGCCGGACGTG
ATCCCGTTCCGGGACTCGGGCATCCGGCCTGTGCTGACGCTGGCTTCTGTATCGGGACCGCCTTGTCCGGTCGTA
TCTGGCTCTCATCCGTCGTTGCTGATCCGACCAGACTCGTCGACAGCCGTCACGCTCTCCCCAACGACATTCGGA
GCCTCAGGAATAGCCGAGACGCGAGACAGGGTCCGCCGCCAGCTTCGTCTGCTCTTCATCTACCCCATGGTTTAC
ATGGGCTTGTGGACCGTCCCCCTGATCTGCCACATCACGAGCGTCCTCGACCGCGGCGAAACCGTCGGCCTCAGC
CTAGCCAGCATCGCCAGTCTCAGCCTGCAGGGAGTCGCCGACGCTCTCGTGTTCCTCGTCGTGGAGAAGCCGTGG
CGTCTGCCGCGGCATGGCGACGCCTCTTGCTGGCTCGTTCACGCCATACAGGGCACCGCGGTGACGACCACCACC
AACGCTGGCCGCAGTCGCGACGAGATGCGCTTCGACAGCCGCGTCGCGAGACGTCGTCGAGAAGGAGAGCGCGCT
GCCGAGCGTCGTTCCAAGCACAGCCCCGGCCGCGTGCGCGAGTGGTGGGAGGTTGGTGTCGAGACTGATGTGGAA
GACGACGGCTACAGCGACACGTGA
Transcript >Ophcf2|06312
ATGCCCCTTTCAAGCCCCGCCCCCCTGACCATCAGCCCACAAGGCCACAAGCTGGCCATCAACGTGACTTGCCTC
GTCCTCGCAAGCCTAAGTGTCGTGGCCACGGCTTGGGCCAAGATCCTCATCGTGATCCTCCTCCAAATCGACCTC
TTCAAATCAGCCATCCTCGTCCTCGTCCCCGCCATAGAACTCGTCCACGGTCCCGTCATCTCAGGCTCGACAACA
TGTCACGTCATCGGTTGCGTCCTTCTCATCACTCTGGAAGCCTGCAACGTCGCCATCGTCCTCCTCGCTCTGCAC
ACGGCCCTCAACGTATTCCGAGGCGAAGGGGGACTGTACCCGCATCGACGTCTGGCTTGGGCTGTCGGCCTCGTG
CTACCTCTGGCTCTCGCTTCGCTTGCCTTCATCAATAGGCCTGCTTTTGTCAATACCGATGGCTTCTGTCAAGTT
CCTGAGAGGCCGAGGTGGCCGAAGCGGGTGCTAATATGGCTCCCTCGCGGCCTGTGTCTCGTCATCATCGTCTTC
ACTTACGTTGCCACCTTTGTACACGTTCAGAAGCTCATGAGACGCTTCGTCGCTGGGCCTGCACAGCCGGGACCT
AGGATCAAGGCAGTCGAACCGCCCCCGCCGCCTTCGCTGGCCTCGCTCCGTCTCGGTCCGTGGCAGCCGGACGTG
ATCCCGTTCCGGGACTCGGGCATCCGGCCTGTGCTGACGCTGGCTTCTGTATCGGGACCGCCTTGTCCGGTCGTA
TCTGGCTCTCATCCGTCGTTGCTGATCCGACCAGACTCGTCGACAGCCGTCACGCTCTCCCCAACGACATTCGGA
GCCTCAGGAATAGCCGAGACGCGAGACAGGGTCCGCCGCCAGCTTCGTCTGCTCTTCATCTACCCCATGGTTTAC
ATGGGCTTGTGGACCGTCCCCCTGATCTGCCACATCACGAGCGTCCTCGACCGCGGCGAAACCGTCGGCCTCAGC
CTAGCCAGCATCGCCAGTCTCAGCCTGCAGGGAGTCGCCGACGCTCTCGTGTTCCTCGTCGTGGAGAAGCCGTGG
CGTCTGCCGCGGCATGGCGACGCCTCTTGCTGGCTCGTTCACGCCATACAGGGCACCGCGGTGACGACCACCACC
AACGCTGGCCGCAGTCGCGACGAGATGCGCTTCGACAGCCGCGTCGCGAGACGTCGTCGAGAAGGAGAGCGCGCT
GCCGAGCGTCGTTCCAAGCACAGCCCCGGCCGCGTGCGCGAGTGGTGGGAGGTTGGTGTCGAGACTGATGTGGAA
GACGACGGCTACAGCGACACGTGA
Gene >Ophcf2|06312
ATGCCCCTTTCAAGCCCCGCCCCCCTGACCATCAGCCCACAAGGCCACAAGCTGGCCATCAACGTGACTTGCCTC
GTCCTCGCAAGCCTAAGTGTCGTGGCCACGGCTTGGGCCAAGATGTGCTTCCTTCGCGTACGGAAGAACTTTCGC
TACGAGCGCGTTTTCACCCCCCCCCTTTCCTACTCTACATGAAAACTTGATCCATCAGCTAAGAGAGAAACAGCC
TCATCGTGATCCTCCTCCAAATCGACCTCTTCAAATCAGCCATCCTCGTCCTCGTCCCCGCCATAGAACTCGTCC
ACGGTCCCGTCATCTCAGGCTCGACAACATGTCACGTCATCGGTTGCGTCCTTCTCATCACTCTGGAAGCCTGCA
ACGTCGCCATCGTCCTCCTCGCTCTGCACACGGCCCTCAACGTATTCCGAGGCGAAGGGGGACTGTACCCGCATC
GACGTCTGGCTTGGGCTGTCGGCCTCGTGCTACCTCTGGCTCTCGCTTCGCTTGCCTTCATCAATAGGCCTGCTT
TTGTCAATACCGATGGCTTCTGTCAAGTTCCTGAGAGGCCGAGGTGGCCGAAGCGGGTGCTAATATGGCTCCCTC
GCGGCCTGTGTCTCGTCATCATCGTCTTCACTTACGTTGCCACCTTTGTACACGTTCAGAAGCTCATGAGACGCT
TCGTCGCTGGGCCTGCACAGCCGGGACCTAGGATCAAGGCAGTCGAACCGCCCCCGCCGCCTTCGCTGGCCTCGC
TCCGTCTCGGTCCGTGGCAGCCGGACGTGATCCCGTTCCGGGACTCGGGCATCCGGCCTGTGCTGACGCTGGCTT
CTGTATCGGGACCGCCTTGTCCGGTCGTATCTGGCTCTCATCCGTCGTTGCTGATCCGACCAGACTCGTCGACAG
CCGTCACGCTCTCCCCAACGACATTCGGAGCCTCAGGAATAGCCGAGACGCGAGACAGGGTCCGCCGCCAGCTTC
GTCTGCTCTTCATCTACCCCATGGTTTACATGGGCTTGTGGACCGTCCCCCTGATCTGCCACATCACGAGCGTCC
TCGACCGCGGCGAAACCGTCGGCCTCAGCCTAGCCAGCATCGCCAGTCTCAGCCTGCAGGGAGTCGCCGACGCTC
TCGTGTTCCTCGTCGTGGAGAAGCCGTGGCGTCTGCCGCGGCATGGCGACGCCTCTTGCTGGCTCGTTCACGCCA
TACAGGGCACCGCGGTGACGACCACCACCAACGCTGGCCGCAGTCGCGACGAGATGCGCTTCGACAGCCGCGTCG
CGAGACGTCGTCGAGAAGGAGAGCGCGCTGCCGAGCGTCGTTCCAAGCACAGCCCCGGCCGCGTGCGCGAGTGGT
GGGAGGTTGGTGTCGAGACTGATGTGGAAGACGACGGCTACAGCGACACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail