Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06310
Gene name
Locationscaffold_07:1911844..1913502
Strand-
Gene length (bp)1658
Transcript length (bp)702
Coding sequence length (bp)702
Protein length (aa) 234

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Signal peptide 0.0937 0.132 0.6261 0.7175 0.0929 0.0097 0.0469 0.3834 0.165 0.1118

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 157 179 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 33.71 14.88 52.55
Alive In ants, during behavior modification 23.18 7.75 38.61
Dead In ants, recently dead 15.67 5.12 26.21

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.171377 no
Alive Dead 0.126830 no
Dead Fungus 0.004828 yes

Orthologs

Orthofinder run ID4
Orthogroup4740
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6798
Ophiocordyceps australis map64 (Brazil) OphauB2|2809
Ophiocordyceps australis map64 (Brazil) OphauB2|3487
Ophiocordyceps camponoti-floridani Ophcf2|06310 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2262
Ophiocordyceps kimflemingae Ophio5|7334

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06310
MDDPRDRLGLQCPPTSVFYICKDTPKRFLGCCTIDACQRGGDCPLPNIESATFNASRYQDIPPQECDSASALWYT
CKFTRPPFLGCCRQNPCTQTSGCPAGALGVGVLNRDPSLAASLLPMSATTTTTTRRTATPTTSKTPSTTPSGDAG
SISKGTAAGISIGVSAALISLLSALVVFLYRRKKRKSSKDDNIRSTTLETSARTSPDQSPSYLNHRVSPMSGCTS
PSPPARVS*
Coding >Ophcf2|06310
ATGGACGACCCCCGCGATAGATTAGGCCTCCAATGCCCCCCAACCAGCGTCTTCTACATCTGCAAAGACACCCCC
AAGCGCTTCCTTGGCTGCTGCACCATCGACGCCTGCCAACGAGGCGGCGACTGTCCGCTCCCCAACATCGAGTCC
GCCACTTTCAACGCCTCCCGCTACCAAGACATCCCTCCGCAGGAGTGTGATTCCGCCTCGGCCCTATGGTATACC
TGCAAGTTCACCAGGCCGCCTTTCCTCGGCTGCTGCCGACAGAATCCGTGTACGCAGACGAGTGGTTGTCCGGCC
GGAGCGTTGGGCGTCGGCGTCTTGAATAGGGATCCTTCTCTTGCGGCTTCCTTGCTTCCCATGTCTGCGACGACG
ACGACGACGACGAGGAGGACTGCCACTCCTACAACCAGCAAGACTCCCTCGACGACCCCTTCCGGAGACGCGGGC
AGCATCTCCAAAGGAACAGCAGCAGGCATCAGCATCGGCGTCTCGGCCGCTCTCATAAGCCTCCTTTCCGCCCTC
GTCGTCTTCCTCTACCGACGCAAGAAGCGTAAATCCAGCAAGGATGACAACATACGAAGCACGACGCTCGAGACG
TCAGCCCGCACCAGCCCGGACCAGTCCCCGTCTTACCTCAACCACCGGGTCTCTCCCATGAGCGGCTGCACGTCT
CCGTCGCCACCCGCGCGGGTTAGCTAA
Transcript >Ophcf2|06310
ATGGACGACCCCCGCGATAGATTAGGCCTCCAATGCCCCCCAACCAGCGTCTTCTACATCTGCAAAGACACCCCC
AAGCGCTTCCTTGGCTGCTGCACCATCGACGCCTGCCAACGAGGCGGCGACTGTCCGCTCCCCAACATCGAGTCC
GCCACTTTCAACGCCTCCCGCTACCAAGACATCCCTCCGCAGGAGTGTGATTCCGCCTCGGCCCTATGGTATACC
TGCAAGTTCACCAGGCCGCCTTTCCTCGGCTGCTGCCGACAGAATCCGTGTACGCAGACGAGTGGTTGTCCGGCC
GGAGCGTTGGGCGTCGGCGTCTTGAATAGGGATCCTTCTCTTGCGGCTTCCTTGCTTCCCATGTCTGCGACGACG
ACGACGACGACGAGGAGGACTGCCACTCCTACAACCAGCAAGACTCCCTCGACGACCCCTTCCGGAGACGCGGGC
AGCATCTCCAAAGGAACAGCAGCAGGCATCAGCATCGGCGTCTCGGCCGCTCTCATAAGCCTCCTTTCCGCCCTC
GTCGTCTTCCTCTACCGACGCAAGAAGCGTAAATCCAGCAAGGATGACAACATACGAAGCACGACGCTCGAGACG
TCAGCCCGCACCAGCCCGGACCAGTCCCCGTCTTACCTCAACCACCGGGTCTCTCCCATGAGCGGCTGCACGTCT
CCGTCGCCACCCGCGCGGGTTAGCTAA
Gene >Ophcf2|06310
ATGGACGACCCCCGCGATAGATTAGGCCTCCAATGCCCCCCAACCAGCGTCTTCTACATCTGCAAAGACACCCCC
AAGCGCTTCCTTGGCTGCTGCACCATCGACGCCTGCCAACGAGGCGGCGACTGTCCGCTCCCCAACATCGAGTCC
GCCACTTTCAACGCCTCCCGCTACCAAGACATCCCTCCGCAGGAGTGTGATTCCGCCTCGGCCCTATGGTATACC
TGCAAGTTCACCAGGCCGCCTTTCCTCGGCTGCTGCCGACAGAATCCGTGTACGCAGACGAGTGGTTGTCCGGCC
GGAGCGTTGGGCGTCGGCGTCTTGAATAGGGATCCTTCTCTTGCGGCTTCCTTGCTTCCCATGTCTGCGACGACG
ACGACGACGACGAGGAGGACTGCCACTCCTACAACCAGCAAGACTCCCTCGACGACCCCTTCCGGAGACGCGGGC
AGCATCTCCAAAGGAACAGCAGCAGGCATCAGCATCGGCGTCTCGGCCGCTCTCATAAGCCTCCTTTCCGCCCTC
GTCGTCTTCCTCTACCGACGCAAGAAGCGTAAATCCAGCAAGGATGACAACATACGAAGCACGACGCTCGAGACG
TCAGCCCGCACCAGCCCGGACCAGTCCCCGTCTTACCTCAACCACCGGGTCTCTCCCATGAGCGGCTGCACGTCT
CCGTCGCCACCCGCGCGGTTCGCCTCCATCATCGGCCCGGATGATACCTGCACCGTTTCCGAGATGGATGCTTCG
ACGGAGAAGACTCGGCCGGTTGAGTTGGAGGATCCGCGGACGTGGATGAGGAGGGGGGTGGGGGCTGATGAATGT
TGTATATGTTTGGGGGGGGGGAATGATTGTATCTATAATCGATATTGGGAGGGTTGATATCTCTTAGCCGTGGCA
CAGAGGCCTTCTCTCTTATACGACGGGCTTCTGTTCGCCTGTTGCACCGCATACGATAGATGCGCGAGAAACAAG
GCAAAGAAGGTCGCGAACCATTCGACAGCCACGGGATCCGTGCACGCATATGTCGGTGGCTATAGGGCATAAAGA
GCAATTAGCTAGTACGAGGCAGTGGCTAGGATAGCCCTCCCTCGTAATATTTACGGACTAGGGTAATTAGCTACC
GTAAGACAATAGCTAGGACAGCCTTCCCTAGTAGAAATAATTAGGAATATACCTATAGAAGAACTAGGCTATAAG
AAAGGATTAGAATTCTCCCTTAGATAGTATTAGATAATTAAGATTATAACTCTCTTTATATCTCTCATATTTTTC
TACTCTATATCTTATAATTACTATTATTTAGTTATTCTATTATAATCCCTATTAGATTTACTTATAGCTATTTAA
TAGTTATAAGCCTAGGAGGCTATAAGAATAATTATAATAACTTATAACTTTTCTATAATAAATTATTATTAGTTA
TTAAATTAATAATAAACCTTTTATTATTAGAATAATACTAATATTTATAAAAATATTAATAGAATTAAATACTTT
ATAAGCTAAGCTTACTAACCTTAAAGACTAAGATATATAAAAAGAGAAGTAATAAGTAAGATTAACTCTCTAGCC
TATAATATAATTTTCTTAGACTATAAAAAGAACTAAGAAAGGTAATTACTCTTACCTTTTAAATGTATCCTAGGG
TTAGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail