Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06308
Gene name
Locationscaffold_07:1850868..1857672
Strand+
Gene length (bp)6804
Transcript length (bp)4431
Coding sequence length (bp)4431
Protein length (aa) 1477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 3.8E-28 629 743
PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop 2.7E-30 131 338
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 1.1E-28 1267 1457
PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor 8.7E-26 22 115
PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1 1.7E-23 345 444
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 6.0E-17 1069 1190
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 7.4E-17 521 588
PF13246 Cation_ATPase Cation transport ATPase (P-type) 2.3E-12 928 1020

GO

GO Term Description Terminal node
GO:0031124 mRNA 3'-end processing Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0006397 mRNA processing No
GO:0044237 cellular metabolic process No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0016071 mRNA metabolic process No
GO:0031123 RNA 3'-end processing No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 589 611 22
2 786 808 22
3 818 840 22
4 1236 1258 22
5 1273 1290 17
6 1320 1342 22
7 1364 1383 19
8 1404 1426 22
9 1436 1458 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06308
MSIPGLGQIPAPSAASSTRTITLKTAWEWRFEVAAGRSIVVKILSGTAEKDGIELAPRGTYTFSGVKSKILTWHG
CELEVDGRCDDDFVAEYVAPADNPANAVLNLHAQLKEMRTVAARLGREGPRVLIAGPPNTGKTTMVRTLASYATR
QGHQPIAVNVDPREAMLSLPGTLVAAVLATVLDPEAVDGWGSTPTSGPSSVPVKLPLVYMHGRASAEDDAELYKE
LVARLATAVSGRSSADAHVRSSGIIVDTMRVSEKSKIGLDLIAHVVDEFSINVVVVVGSTRMNAELSKRFAEEKT
SLGEPIHVILLDRSEGVVERDEAFMDHAREQVIKEYFFGDERRALSPQIQQVDFDSLVVYRTPEYSMLGQESLVR
EEPSSVMEHWTLAVMHASFKDAPEVVRAASVMGFVYVSDVDEERRKMKILAPVGGRLGDRPLILGKWPEPTSLAD
IINKAPRSLARDDAADLGGVNIELQPLLRVRNPPEAELPSAESKTVVSPNDKSRPAPGLRSVAIEKPQLAHTLPA
ELVALQLGTDLEDGLTDDEAAVRLARDGPNTIKTAPAVSLWRVLFRQIANALTMVLIFVAALSLGIHDYAEGGAV
VFVIILNIVVGLTQDYRAERTIQALYVLSTPRCKVIRDGHSQTIKAVTLVVGDVVSLVTGDIVPADLRLVKGTNM
AMAEAPLTGESVDVTKTPDAVFDDAEMPIGDRSNIAFAGCSVSCGRATGIVVATGMETEVGRIAHMLRCGDDDDG
SRDESFYARTMRSLHQGLRGILGLQGTPLQVTLSKFAFGLFGLAFLLVIIVFSIHNWRLSHDVLKYGVCVGVAVI
PESLLAVVTVTMAVASKAMAKGHVIVRRMPCLEAVGGVTNICSDKTGTLTQGRMVVRRVWLRDGLTGTVEGSLDP
YDPASGSVSWSGPVKDGRLDVLLSTLTVCNHATVTDGKKEAETDSSSVMTAPQWHAVGEPTEVALRVFAMRFGRG
GTPIKNSTAEFPFDSTRKLMSVVCGCPSDASRRVHTKGAVEVMLPLLDETGELLKAINDEAESMAAGGLRVLCIA
DRVMTEEGLDRARVEQGLHFLGLVGLYDPPRPESALAVKQCREAGISVHMLTGDHIKTASAVAREVGILSTDYAG
DVMSASSFGRLSDEQMDGLEKLPAVIARCSPLTKVRVIQALHRRGAFCVMTGDGINDSPALKQADVGIAMGDRGS
DVAKEASDMVLTDDNFASIVTGIREGRRLADNIQKFLLHLLTSNLAQVILLLIALVFKDCDGACVFPLSPMEILW
ANLIMSSPLAVGLGLEEAQPDILKRPPRSLHRGVFTLDLVRDQLVYGALMGGLSLGTFMLVTFTGIWSPDYNKLP
CNCNHYQGAKCDAIFRARGATFATLSLLLLVMALEVRSSHRSLLDSGPVWRNRVLGWGLVGGLAMIFPLLYIPHI
NTHLFRHGGLTWEWGIVMGSVATFVMLVEVWKAGKRRKLPGRMTSEGPVPD*
Coding >Ophcf2|06308
ATGTCGATTCCTGGTCTGGGACAGATTCCGGCTCCGTCCGCTGCTTCGTCTACACGAACCATTACCCTCAAAACG
GCATGGGAATGGCGGTTCGAGGTAGCCGCAGGGCGATCGATCGTCGTCAAGATACTCTCCGGGACGGCAGAAAAG
GACGGGATAGAGCTTGCACCGCGCGGGACCTATACCTTCTCAGGCGTCAAGTCCAAGATCCTCACTTGGCACGGT
TGCGAGCTCGAGGTCGACGGCAGATGCGACGATGACTTCGTGGCAGAGTACGTGGCTCCAGCAGACAACCCGGCC
AACGCCGTCCTCAACCTACACGCGCAACTCAAAGAGATGCGCACCGTCGCAGCTCGTCTTGGCCGCGAGGGCCCG
CGCGTGCTCATTGCCGGTCCCCCTAACACGGGCAAGACGACCATGGTTCGCACGCTGGCCAGTTACGCCACCCGT
CAAGGCCACCAGCCTATAGCCGTCAACGTCGATCCGCGCGAGGCCATGCTGTCCTTACCAGGAACCCTGGTCGCC
GCCGTGCTCGCCACTGTCCTTGATCCCGAAGCGGTTGATGGCTGGGGCAGCACTCCGACGAGCGGGCCCAGCAGC
GTGCCTGTCAAGCTGCCGCTGGTATACATGCATGGCCGTGCCTCGGCCGAGGACGATGCCGAACTCTACAAGGAG
CTGGTCGCTCGTCTCGCCACCGCCGTCAGCGGCCGTTCCAGCGCCGACGCCCACGTTCGCAGCTCTGGCATCATC
GTCGATACCATGCGTGTCAGTGAGAAGAGCAAGATCGGACTAGACCTGATAGCTCACGTCGTCGACGAGTTCTCC
ATCAACGTCGTCGTTGTCGTCGGCTCCACTAGGATGAATGCCGAGCTCAGCAAGCGGTTTGCCGAAGAGAAGACG
AGCCTTGGCGAGCCCATCCACGTCATCTTGCTTGACCGGTCCGAGGGTGTTGTCGAACGCGACGAGGCTTTCATG
GACCACGCACGCGAGCAGGTCATCAAGGAATACTTCTTCGGTGACGAGCGCAGGGCCCTGAGTCCGCAGATCCAA
CAAGTCGACTTTGACAGTCTTGTCGTGTACAGGACGCCCGAATATTCGATGCTCGGACAGGAGAGCCTGGTTCGC
GAGGAGCCGAGCTCCGTCATGGAGCATTGGACGTTGGCCGTCATGCACGCCTCGTTCAAGGATGCGCCCGAGGTG
GTACGCGCGGCCAGCGTCATGGGCTTCGTCTACGTGTCCGACGTGGACGAGGAGCGGCGCAAGATGAAGATACTC
GCACCCGTCGGCGGGCGTCTTGGCGACCGACCGCTCATCTTGGGGAAGTGGCCGGAGCCGACCTCGCTGGCAGAT
ATCATTAACAAGGCGCCTCGCTCTCTTGCTCGTGACGACGCGGCTGATCTCGGCGGCGTCAACATCGAGCTTCAA
CCTCTCCTCCGAGTCCGGAATCCCCCTGAAGCTGAACTCCCCTCTGCCGAGTCCAAGACTGTCGTCTCCCCCAAC
GACAAATCTCGGCCCGCCCCGGGGCTTCGAAGTGTGGCCATAGAGAAGCCGCAGCTCGCCCACACCCTTCCCGCC
GAGCTCGTTGCTCTTCAACTCGGCACCGACCTCGAAGATGGGTTGACCGACGACGAGGCGGCCGTCCGCTTGGCT
CGCGACGGTCCAAACACCATCAAGACTGCTCCGGCTGTTTCGCTTTGGCGAGTGCTCTTTCGACAGATTGCCAAC
GCCCTGACCATGGTGCTCATCTTCGTCGCCGCCTTGTCCTTGGGTATCCATGACTATGCCGAGGGAGGTGCTGTC
GTCTTTGTCATTATCCTCAATATTGTTGTTGGACTCACTCAAGACTACCGTGCCGAGCGGACGATTCAGGCCCTC
TATGTCCTGTCGACGCCACGATGCAAGGTGATTCGTGACGGCCACAGCCAGACCATCAAGGCCGTGACGCTCGTC
GTCGGCGACGTGGTCTCGCTCGTCACGGGGGACATTGTCCCTGCCGACCTTCGCCTCGTCAAGGGCACCAACATG
GCCATGGCCGAGGCGCCGCTGACGGGAGAGTCGGTGGATGTGACCAAGACACCCGACGCCGTCTTTGACGACGCC
GAGATGCCCATCGGTGACCGGAGCAACATTGCCTTTGCCGGCTGTTCCGTCAGCTGCGGCCGGGCCACAGGCATC
GTCGTGGCCACGGGGATGGAGACGGAGGTCGGCCGCATTGCCCACATGCTACGCTGTGGCGATGATGACGACGGC
AGCCGCGACGAGAGCTTCTACGCCAGGACCATGAGGAGCCTCCATCAGGGACTCCGCGGCATACTGGGCCTCCAA
GGGACCCCCCTCCAGGTGACGCTCAGCAAGTTCGCCTTTGGCCTGTTCGGGCTGGCCTTTCTGCTCGTCATCATC
GTCTTCTCCATACACAACTGGAGGCTCAGTCACGACGTGCTCAAGTACGGCGTCTGCGTGGGCGTGGCCGTGATT
CCCGAGTCGCTGCTGGCGGTGGTGACGGTGACGATGGCGGTGGCGTCCAAGGCCATGGCCAAAGGCCACGTCATT
GTCCGTCGCATGCCTTGTCTCGAGGCCGTCGGGGGCGTGACGAACATCTGCTCGGACAAGACGGGCACGCTGACG
CAGGGCCGGATGGTGGTGAGACGCGTCTGGCTCCGTGACGGCCTGACGGGGACGGTCGAGGGGTCTTTGGATCCG
TATGATCCGGCCAGCGGAAGCGTCTCGTGGTCCGGTCCGGTCAAGGACGGCCGTCTAGACGTCTTGCTCAGCACG
TTGACGGTCTGTAATCACGCGACGGTGACGGACGGAAAGAAGGAGGCCGAGACGGACTCGAGCAGCGTCATGACG
GCTCCGCAATGGCATGCCGTCGGGGAGCCGACCGAGGTAGCGCTCCGAGTGTTTGCCATGCGTTTCGGACGAGGA
GGCACGCCCATCAAGAACTCGACGGCCGAGTTCCCCTTTGACTCGACGCGGAAGCTCATGAGCGTCGTTTGCGGA
TGCCCGTCGGACGCGTCACGACGGGTGCACACCAAGGGCGCCGTCGAGGTGATGCTGCCGCTGCTGGACGAGACG
GGAGAGCTCCTCAAGGCCATCAACGACGAGGCCGAGTCGATGGCGGCCGGCGGACTGCGCGTGCTGTGTATCGCG
GACAGGGTCATGACGGAAGAGGGCCTCGACCGGGCCCGTGTCGAGCAGGGGCTACACTTCCTCGGCCTCGTCGGC
CTCTACGACCCGCCGAGACCCGAGTCCGCCCTGGCGGTGAAGCAGTGTCGCGAAGCCGGCATCTCGGTGCACATG
CTGACGGGGGATCACATCAAGACAGCCTCGGCCGTGGCCCGCGAGGTGGGCATCCTCTCGACGGACTATGCCGGA
GACGTCATGTCGGCCTCCTCCTTCGGCCGTCTCAGCGATGAGCAGATGGACGGGCTCGAGAAGCTACCGGCCGTC
ATCGCCCGCTGCAGCCCCCTGACCAAGGTGCGCGTCATCCAGGCACTGCACCGACGGGGGGCCTTTTGCGTCATG
ACGGGCGACGGCATCAACGACTCGCCGGCGCTGAAGCAGGCGGACGTCGGCATCGCCATGGGCGACAGGGGCAGC
GACGTGGCCAAGGAGGCGTCCGACATGGTGCTCACGGACGACAACTTTGCCTCGATCGTCACGGGTATTCGCGAG
GGAAGACGGCTGGCTGACAATATTCAAAAGTTTCTGCTACATCTCCTCACCTCCAACCTGGCCCAGGTCATCCTG
CTGCTGATCGCCCTCGTCTTCAAGGACTGCGACGGCGCCTGCGTCTTCCCCCTGTCGCCCATGGAGATCCTCTGG
GCCAACCTGATCATGTCGTCGCCGCTGGCCGTCGGTCTGGGCCTCGAAGAAGCGCAGCCGGACATACTCAAGCGT
CCCCCGCGGAGTCTGCATAGGGGCGTCTTCACGCTGGACCTGGTGCGCGACCAGCTCGTGTACGGGGCGCTGATG
GGAGGACTCAGCCTCGGGACTTTTATGCTGGTGACGTTTACCGGGATATGGTCACCGGATTACAACAAGCTGCCG
TGCAATTGCAACCATTACCAGGGTGCAAAGTGCGACGCCATCTTCAGGGCTCGGGGCGCGACGTTTGCGACGCTG
AGCCTGCTCCTGCTGGTCATGGCGCTGGAGGTGCGGAGTTCTCATCGAAGCCTGCTCGATTCGGGGCCCGTGTGG
CGCAACCGAGTGCTGGGATGGGGGCTCGTCGGGGGGCTGGCCATGATATTCCCCCTCCTGTACATTCCGCACATC
AACACCCATCTGTTCCGTCACGGGGGGTTGACGTGGGAGTGGGGGATCGTCATGGGCTCGGTGGCGACGTTTGTC
ATGCTCGTCGAGGTTTGGAAGGCGGGGAAGAGGAGAAAGCTCCCGGGGCGTATGACCTCCGAGGGCCCTGTCCCG
GACTGA
Transcript >Ophcf2|06308
ATGTCGATTCCTGGTCTGGGACAGATTCCGGCTCCGTCCGCTGCTTCGTCTACACGAACCATTACCCTCAAAACG
GCATGGGAATGGCGGTTCGAGGTAGCCGCAGGGCGATCGATCGTCGTCAAGATACTCTCCGGGACGGCAGAAAAG
GACGGGATAGAGCTTGCACCGCGCGGGACCTATACCTTCTCAGGCGTCAAGTCCAAGATCCTCACTTGGCACGGT
TGCGAGCTCGAGGTCGACGGCAGATGCGACGATGACTTCGTGGCAGAGTACGTGGCTCCAGCAGACAACCCGGCC
AACGCCGTCCTCAACCTACACGCGCAACTCAAAGAGATGCGCACCGTCGCAGCTCGTCTTGGCCGCGAGGGCCCG
CGCGTGCTCATTGCCGGTCCCCCTAACACGGGCAAGACGACCATGGTTCGCACGCTGGCCAGTTACGCCACCCGT
CAAGGCCACCAGCCTATAGCCGTCAACGTCGATCCGCGCGAGGCCATGCTGTCCTTACCAGGAACCCTGGTCGCC
GCCGTGCTCGCCACTGTCCTTGATCCCGAAGCGGTTGATGGCTGGGGCAGCACTCCGACGAGCGGGCCCAGCAGC
GTGCCTGTCAAGCTGCCGCTGGTATACATGCATGGCCGTGCCTCGGCCGAGGACGATGCCGAACTCTACAAGGAG
CTGGTCGCTCGTCTCGCCACCGCCGTCAGCGGCCGTTCCAGCGCCGACGCCCACGTTCGCAGCTCTGGCATCATC
GTCGATACCATGCGTGTCAGTGAGAAGAGCAAGATCGGACTAGACCTGATAGCTCACGTCGTCGACGAGTTCTCC
ATCAACGTCGTCGTTGTCGTCGGCTCCACTAGGATGAATGCCGAGCTCAGCAAGCGGTTTGCCGAAGAGAAGACG
AGCCTTGGCGAGCCCATCCACGTCATCTTGCTTGACCGGTCCGAGGGTGTTGTCGAACGCGACGAGGCTTTCATG
GACCACGCACGCGAGCAGGTCATCAAGGAATACTTCTTCGGTGACGAGCGCAGGGCCCTGAGTCCGCAGATCCAA
CAAGTCGACTTTGACAGTCTTGTCGTGTACAGGACGCCCGAATATTCGATGCTCGGACAGGAGAGCCTGGTTCGC
GAGGAGCCGAGCTCCGTCATGGAGCATTGGACGTTGGCCGTCATGCACGCCTCGTTCAAGGATGCGCCCGAGGTG
GTACGCGCGGCCAGCGTCATGGGCTTCGTCTACGTGTCCGACGTGGACGAGGAGCGGCGCAAGATGAAGATACTC
GCACCCGTCGGCGGGCGTCTTGGCGACCGACCGCTCATCTTGGGGAAGTGGCCGGAGCCGACCTCGCTGGCAGAT
ATCATTAACAAGGCGCCTCGCTCTCTTGCTCGTGACGACGCGGCTGATCTCGGCGGCGTCAACATCGAGCTTCAA
CCTCTCCTCCGAGTCCGGAATCCCCCTGAAGCTGAACTCCCCTCTGCCGAGTCCAAGACTGTCGTCTCCCCCAAC
GACAAATCTCGGCCCGCCCCGGGGCTTCGAAGTGTGGCCATAGAGAAGCCGCAGCTCGCCCACACCCTTCCCGCC
GAGCTCGTTGCTCTTCAACTCGGCACCGACCTCGAAGATGGGTTGACCGACGACGAGGCGGCCGTCCGCTTGGCT
CGCGACGGTCCAAACACCATCAAGACTGCTCCGGCTGTTTCGCTTTGGCGAGTGCTCTTTCGACAGATTGCCAAC
GCCCTGACCATGGTGCTCATCTTCGTCGCCGCCTTGTCCTTGGGTATCCATGACTATGCCGAGGGAGGTGCTGTC
GTCTTTGTCATTATCCTCAATATTGTTGTTGGACTCACTCAAGACTACCGTGCCGAGCGGACGATTCAGGCCCTC
TATGTCCTGTCGACGCCACGATGCAAGGTGATTCGTGACGGCCACAGCCAGACCATCAAGGCCGTGACGCTCGTC
GTCGGCGACGTGGTCTCGCTCGTCACGGGGGACATTGTCCCTGCCGACCTTCGCCTCGTCAAGGGCACCAACATG
GCCATGGCCGAGGCGCCGCTGACGGGAGAGTCGGTGGATGTGACCAAGACACCCGACGCCGTCTTTGACGACGCC
GAGATGCCCATCGGTGACCGGAGCAACATTGCCTTTGCCGGCTGTTCCGTCAGCTGCGGCCGGGCCACAGGCATC
GTCGTGGCCACGGGGATGGAGACGGAGGTCGGCCGCATTGCCCACATGCTACGCTGTGGCGATGATGACGACGGC
AGCCGCGACGAGAGCTTCTACGCCAGGACCATGAGGAGCCTCCATCAGGGACTCCGCGGCATACTGGGCCTCCAA
GGGACCCCCCTCCAGGTGACGCTCAGCAAGTTCGCCTTTGGCCTGTTCGGGCTGGCCTTTCTGCTCGTCATCATC
GTCTTCTCCATACACAACTGGAGGCTCAGTCACGACGTGCTCAAGTACGGCGTCTGCGTGGGCGTGGCCGTGATT
CCCGAGTCGCTGCTGGCGGTGGTGACGGTGACGATGGCGGTGGCGTCCAAGGCCATGGCCAAAGGCCACGTCATT
GTCCGTCGCATGCCTTGTCTCGAGGCCGTCGGGGGCGTGACGAACATCTGCTCGGACAAGACGGGCACGCTGACG
CAGGGCCGGATGGTGGTGAGACGCGTCTGGCTCCGTGACGGCCTGACGGGGACGGTCGAGGGGTCTTTGGATCCG
TATGATCCGGCCAGCGGAAGCGTCTCGTGGTCCGGTCCGGTCAAGGACGGCCGTCTAGACGTCTTGCTCAGCACG
TTGACGGTCTGTAATCACGCGACGGTGACGGACGGAAAGAAGGAGGCCGAGACGGACTCGAGCAGCGTCATGACG
GCTCCGCAATGGCATGCCGTCGGGGAGCCGACCGAGGTAGCGCTCCGAGTGTTTGCCATGCGTTTCGGACGAGGA
GGCACGCCCATCAAGAACTCGACGGCCGAGTTCCCCTTTGACTCGACGCGGAAGCTCATGAGCGTCGTTTGCGGA
TGCCCGTCGGACGCGTCACGACGGGTGCACACCAAGGGCGCCGTCGAGGTGATGCTGCCGCTGCTGGACGAGACG
GGAGAGCTCCTCAAGGCCATCAACGACGAGGCCGAGTCGATGGCGGCCGGCGGACTGCGCGTGCTGTGTATCGCG
GACAGGGTCATGACGGAAGAGGGCCTCGACCGGGCCCGTGTCGAGCAGGGGCTACACTTCCTCGGCCTCGTCGGC
CTCTACGACCCGCCGAGACCCGAGTCCGCCCTGGCGGTGAAGCAGTGTCGCGAAGCCGGCATCTCGGTGCACATG
CTGACGGGGGATCACATCAAGACAGCCTCGGCCGTGGCCCGCGAGGTGGGCATCCTCTCGACGGACTATGCCGGA
GACGTCATGTCGGCCTCCTCCTTCGGCCGTCTCAGCGATGAGCAGATGGACGGGCTCGAGAAGCTACCGGCCGTC
ATCGCCCGCTGCAGCCCCCTGACCAAGGTGCGCGTCATCCAGGCACTGCACCGACGGGGGGCCTTTTGCGTCATG
ACGGGCGACGGCATCAACGACTCGCCGGCGCTGAAGCAGGCGGACGTCGGCATCGCCATGGGCGACAGGGGCAGC
GACGTGGCCAAGGAGGCGTCCGACATGGTGCTCACGGACGACAACTTTGCCTCGATCGTCACGGGTATTCGCGAG
GGAAGACGGCTGGCTGACAATATTCAAAAGTTTCTGCTACATCTCCTCACCTCCAACCTGGCCCAGGTCATCCTG
CTGCTGATCGCCCTCGTCTTCAAGGACTGCGACGGCGCCTGCGTCTTCCCCCTGTCGCCCATGGAGATCCTCTGG
GCCAACCTGATCATGTCGTCGCCGCTGGCCGTCGGTCTGGGCCTCGAAGAAGCGCAGCCGGACATACTCAAGCGT
CCCCCGCGGAGTCTGCATAGGGGCGTCTTCACGCTGGACCTGGTGCGCGACCAGCTCGTGTACGGGGCGCTGATG
GGAGGACTCAGCCTCGGGACTTTTATGCTGGTGACGTTTACCGGGATATGGTCACCGGATTACAACAAGCTGCCG
TGCAATTGCAACCATTACCAGGGTGCAAAGTGCGACGCCATCTTCAGGGCTCGGGGCGCGACGTTTGCGACGCTG
AGCCTGCTCCTGCTGGTCATGGCGCTGGAGGTGCGGAGTTCTCATCGAAGCCTGCTCGATTCGGGGCCCGTGTGG
CGCAACCGAGTGCTGGGATGGGGGCTCGTCGGGGGGCTGGCCATGATATTCCCCCTCCTGTACATTCCGCACATC
AACACCCATCTGTTCCGTCACGGGGGGTTGACGTGGGAGTGGGGGATCGTCATGGGCTCGGTGGCGACGTTTGTC
ATGCTCGTCGAGGTTTGGAAGGCGGGGAAGAGGAGAAAGCTCCCGGGGCGTATGACCTCCGAGGGCCCTGTCCCG
GACTGA
Gene >Ophcf2|06308
ATGTCGATTCCTGGTCTGGGACAGATTCCGGCTCCGGTAAGTTCTCGTCGTCAATCTTCTACATACTCCTATCCG
GCCGAAAACTGACAAGAGCTGACAGTCCGCTGCTTCGTCTACACGAACCATTACCCTCAAAACGGCATGGGAATG
GCGGTTCGAGGTAGCCGCAGGGCGATCGATCGTCGTCAAGATACTCTCCGGGACGGCAGAAAAGGACGGGATAGA
GCTTGCACCGCGCGGGACCTATACCTTCTCAGGCGTCAAGTCCAAGATCCTCACTTGGCACGGTTGCGAGCTCGA
GGTCGACGGCAGATGCGACGATGACTTCGTGGCAGAGTACGTGGCTCCAGCAGACAACCCGGCCAACGCCGTCCT
CAACCTACACGCGCAACTCAAAGAGATGCGCACCGTCGCAGCTCGTCTTGGCCGCGAGGGCCCGCGCGTGCTCAT
TGCCGGTCCCCCTAACACGGGCAAGACGACCATGGTTCGCACGCTGGCCAGTTACGCCACCCGTCAAGGCCACCA
GCCTATAGCCGTCAACGTCGATCCGCGCGAGGCCATGCTGTCCTTACCAGGAACCCTGGTCGCCGCCGTGCTCGC
CACTGTCCTTGATCCCGAAGCGGTTGATGGCTGGGGCAGCACTCCGACGAGCGGGCCCAGCAGCGTGCCTGTCAA
GCTGCCGCTGGTATACATGCATGGCCGTGCCTCGGCCGAGGACGATGCCGAACTCTACAAGGAGCTGGTCGCTCG
TCTCGCCACCGCCGTCAGCGGCCGTTCCAGCGCCGACGCCCACGTTCGCAGCTCTGGCATCATCGTCGATACCAT
GCGTGTCAGTGAGAAGAGCAAGATCGGACTAGACCTGATAGCTCACGTCGTCGACGAGTTCTCCAGTAGGTGGCA
TGATTCCTCTGTTTGGACTGGCTGACGCGTCCGCAGTCAACGTCGTCGTTGTCGTCGGCTCCACTAGGATGAATG
CCGAGCTCAGCAAGCGGTTTGCCGAAGAGAAGACGAGCCTTGGCGAGCCCATCCACGTCATCTTGCTTGACCGGT
CCGAGGGTGTTGTCGAACGCGACGAGGCTTTCATGGACCACGCACGCGAGCAGGTCATCAAGGAATACTTCTTCG
GTGACGAGCGCAGGGCCCTGAGTCCGCAGATCCAACAAGTCGACTTTGACAGTCTTGTCGTGTACAGGACGCCCG
AATGTACGTCTAGACGCTCAACTCCCGGAGTCTCGGTTGCTGACAGGCGTCAGATTCGATGCTCGGACAGGAGAG
CCTGGTTCGCGAGGAGCCGAGCTCCGTCATGGAGCATTGGACGTTGGCCGTCATGCACGCCTCGTTCAAGGATGC
GCCCGAGGTGGTACGCGCGGCCAGCGTCATGGGCTTCGTCTACGTGTCCGACGTGGACGAGGAGCGGCGCAAGAT
GAAGATACTCGCACCCGTCGGCGGGCGTCTTGGCGACCGACCGCTCATCTTGGGGAAGTGGCCGGAGCCGTACAT
CAACCTGCTGGGCTAGAGCTGCTGCGAGCTGCCCACCTACCTAACCTACCTAATTCACTCAAGCTGGCAAGGCTG
CGGTCTAGTGCCCATCTCAACTCAAGTCTCAGTCGCTAAGGAGAACTCCGCACAGACCGGCGCGGGGATCAAGAC
GAAGCCTTTGAACCGGCCTCTGAACCAGCCTCTTCTCGGCATGGCGCGTGGCTGCCCCGGGAAGCCTCACACCCT
CCCATTTATGCTTATACCCAAGTTCCGGGGCTCGAGTGAGTTTGGGACCCTTTAGCCCTGACATGGGGGTGCGAG
CTCTGAGCTGGAGCCTATTTCATAGATTGGGTAACTGCTCTGGTCGGACGACATGTCGATGGGGGCTTGTTGGCG
AGGACGAGGCATCGTTACTCACAGAAGGGTTAGTCGGTCAACGAGAGGAGAGGCAAGCCCAGCTGCTATCCATGC
GCGTCTTGGGACAATCGGGCAGTGTGATAAGAAAACAAGCTGCGGACGCGCATAAGCCGGAGTTTCAGCACCACG
GCCTGTGCAAGACGACATGGTGGCTTTATCCAGTAGCAGTTACGAGCAACAACGGTTAGACAAGGGCAAGGGTTG
CGGTATATCCTACTGAGGAATTGCCCTCCATTATCGCGCAGTCTCTCAACTCGTCTCCCCGTCTGCATCTCTCGG
ACCGCGTCATGCCTTGGTTCGAGGCTTGGATTACACGTGCAGCGTCGTCACTGCCTTGGAAGGCGTGCTGAAGCT
GGTCCTTGCTTCCAGCCCCCTCCTCCTCTGCTGCTCCCTCCTTTACCTTTTAGCCTTGCCCATCCCTTTCTTTCA
TCTTTCTCCTGCTTCCTATCAGCTCGTCTACCTTTCCTGCAGGGCGGTGAGAGGAGTGTCCGAAGTTCATACTTA
TCCGAGAGCCTACGCTCGCTCGCTCATCCTCGACAACACGGCCTGCGCAACTCCTGACAGGACCTCGCTGGCAGA
TATCATTAACAAGGCGCCTCGCTCTCTTGCTCGTGACGACGCGGCTGATCTCGGCGGCGTCAACATCGAGCTTCA
ACCTCTCCTCCGAGTCCGGAATCCCCCTGAAGTGGGCGAGCCCCCTTTCCCAACACCCATTCGATGGGAGGACCT
GGTACGGCCGATGAAACAGCTGCTAGACAGGCTGAACTCCCCTCTGCCGAGTCCAAGACTGTCGTCTCCCCCAAC
GACAAATCTCGGCCCGCCCCGGGGCTTCGAAGTGTGGCCATAGAGAAGCCGCAGCTCGCCCACACCCTTCCCGCC
GAGCTCGTTGCTCTTCAACTCGGCACCGACCTCGAAGATGGGTTGACCGACGACGAGGCGGCCGTCCGCTTGGCT
CGCGACGGTCCAAACACCATCAAGACTGCTCCGGCTGTTTCGCTTTGGCGAGTGCTCTTTCGACAGATTGCCAAC
GCCCTGACCATGGTGCTCATCTTCGTCGCCGCCTTGTCCTTGGGTATCCATGACTATGCCGAGGGAGGTGCTGTC
GTCTTTGTCATTATCCTCAATATTGTTGTTGGGTACGTATGGCGCGTCTTTTCTTTGTTGGAGAGAAGAGACCTT
TTTGGACTGACGCGAATGGCCAGACTCACTCAAGACTACCGTGCCGAGCGGACGATTCAGGCCCTCTATGTCCTG
TCGACGCCACGATGCAAGGTGATTCGTGACGGCCACAGCCAGACCATCAAGGCCGTGACGCTCGTCGTCGGCGAC
GTGGTCTCGCTCGTCACGGGGGACATTGTCCCTGCCGACCTTCGCCTCGTCAAGGGCACCAACATGGCCATGGCC
GAGGCGCCGCTGACGGGAGAGTCGGTGGATGTGACCAAGACACCCGACGCCGTCTTTGACGACGCCGAGATGCCC
ATCGGTGACCGGAGCAACATTGCCTTTGCCGGCTGTTCCGTCAGCTGCGGCCGGGCCACAGGCATCGTCGTGGCC
ACGGGGATGGAGACGGAGGTCGGCCGCATTGCCCACATGCTACGCTGTGGCGATGATGACGACGGCAGCCGCGAC
GAGAGCTTCTACGCCAGGACCATGAGGAGCCTCCATCAGGGACTCCGCGGCATACTGGGCCTCCAAGGGACCCCC
CTCCAGGTGACGCTCAGCAAGTTCGCCTTTGGCCTGTTCGGGCTGGCCTTTCTGCTCGTCATCATCGTCTTCTCC
ATACACAACTGGAGGCTCAGTCACGACGTGCTCAAGTACGGCGTCTGCGTGGGCGTGGCCGTGATTCCCGAGTCG
CTGCTGGCGGTGGTGACGGTGACGATGGCGGTGGCGTCCAAGGCCATGGCCAAAGGCCACGTCATTGTCCGTCGC
ATGCCTTGTCTCGAGGCCGTCGGGGGCGTGACGAACATCTGCTCGGACAAGACGGGCACGCTGACGCAGGGCCGG
ATGGTGGTGAGACGCGTCTGGCTCCGTGACGGCCTGACGGGGACGGTCGAGGGGTCTTTGGATCCGTATGATCCG
GCCAGCGGAAGCGTCTCGTGGTCCGGTCCGGTCAAGGACGGCCGTCTAGACGTCTTGCTCAGCACGTTGACGGTC
TGTAATCACGCGACGGTGACGGACGGAAAGAAGGAGGCCGAGACGGACTCGAGCAGCGTCATGACGGCTCCGCAA
TGGCATGCCGTCGGGGAGCCGACCGAGGTAGCGCTCCGAGTGTTTGCCATGCGTTTCGGACGAGGAGGCACGCCC
ATCAAGAACTCGACGGCCGAGTTCCCCTTTGACTCGACGCGGAAGCTCATGAGCGTCGTTTGCGGATGCCCGTCG
GACGCGTCACGACGGGTGCACACCAAGGGCGCCGTCGAGGTGATGCTGCCGCTGCTGGACGAGACGGGAGAGCTC
CTCAAGGCCATCAACGACGAGGCCGAGTCGATGGCGGCCGGCGGACTGCGCGTGCTGTGTATCGCGGACAGGGTC
ATGACGGAAGAGGGCCTCGACCGGGCCCGTGTCGAGCAGGGGCTACACTTCCTCGGCCTCGTCGGCCTCTACGAC
CCGCCGAGACCCGAGTCCGCCCTGGCGGTGAAGCAGTGTCGCGAAGCCGGCATCTCGGTGCACATGCTGACGGGG
GATCACATCAAGACAGCCTCGGCCGTGGCCCGCGAGGTGGGCATCCTCTCGACGGACTATGCCGGAGACGTCATG
TCGGCCTCCTCCTTCGGCCGTCTCAGCGATGAGCAGATGGACGGGCTCGAGAAGCTACCGGCCGTCATCGCCCGC
TGCAGCCCCCTGACCAAGGTGCGCGTCATCCAGGCACTGCACCGACGGGGGGCCTTTTGCGTCATGACGGGCGAC
GGCATCAACGACTCGCCGGCGCTGAAGCAGGCGGACGTCGGCATCGCCATGGGCGACAGGGGCAGCGACGTGGCC
AAGGAGGCGTCCGACATGGTGCTCACGGACGACAACTTTGCCTCGATCGTCACGGGTATTCGCGAGGGAAGACGG
CTGGCTGACAATATTCAAAAGGTATGTGTATATATATGTGTGTGTGTGCGTGCGTGTGTGTGTGTGTGTGCGTGC
GTGTGCGTGCGTATATATATATATATATCTAACCTCCAACCCCGTCGTGTGTGTTCGTTTGTCGGTGTGCTAAAG
GCGGCCAACAGTTTCTGCTACATCTCCTCACCTCCAACCTGGCCCAGGTCATCCTGCTGCTGATCGCCCTCGTCT
TCAAGGACTGCGACGGCGCCTGCGTCTTCCCCCTGTCGCCCATGGAGATCCTCTGGGCCAACCTGATCATGTCGT
CGCCGCTGGCCGTCGGTCTGGGCCTCGAAGAAGCGCAGCCGGACATACTCAAGCGTCCCCCGCGGAGTCTGCATA
GGGGCGTCTTCACGCTGGACCTGGTGCGCGACCAGCTCGTGTACGGGGCGCTGATGGGAGGACTCAGCCTCGGGA
CTTTTATGCTGGTGACGTTTACCGGGATATGGTCACCGGATTACAACAAGCTGCCGTGCAATTGCAACCATTACC
AGGGTGCAAAGTGCGACGCCATCTTCAGGGCTCGGGGCGCGACGTTTGCGACGCTGAGCCTGCTCCTGCTGGTCA
TGGCGCTGGAGGTGCGGAGTTCTCATCGAAGCCTGCTCGATTCGGGGCCCGTGTGGCGCAACCGAGTGCTGGGAT
GGGGGCTCGTCGGGGGGCTGGCCATGATATTCCCCCTCCTGTACATTCCGCACATCAACACCCATCTGTTCCGTC
ACGGGGGGTTGACGTGGGAGTGGGGGATCGTCATGGGCTCGGTGGCGACGTTTGTCATGCTCGTCGAGGTTTGGA
AGGCGGGGAAGAGGAGGTTTGGGCTGGGGGGCAGCGGTGGGAGAGGCGGAGGTTGTGAGGTGGTTGATGGGTTGT
TGGATAGGGATGGGGGCTCAGAGATGGATGGGTGATTAGGGATAGGGTTTGGGAGGAGGAGGAGGAGGAGGAGGA
GGAGGAGGAGTAGGAGGAGGTTGGGGGGTTGGAGAGACAGATGTTTGGCTAGTATTGGATTATTCGCTTGGTCCT
CTTGGTTGATGGTGTTGTTGCTTTGCGTGAGTTGCTACTGGCTAGTGAGAGTAGGGGGGCTTGTTTGTAGGGTCT
CGTTTGTAGGGGCTTGTTTGCAGGACAGCACGGTAGGCGTTGTACATGATGAAGCCATAATCCAGAGCGATTGTC
AAGCTGTCCATGACTTCCTAAATGCCAACTCAGCCATCATAGACGTCGACAGAGAGTCTGTCTGTGGCTACATTC
TTGCACGTGGCCCGGCGTGGCTCAACGAACTACAACAACCTAGCGTCTGTCCTTGGTCTCTCCACGACCTCGCAA
CGATGGTTAAGAATGAGACATAAGAAGGGCCGAAAGCCGGCATGTTCTTGACACGCCGTCGAGAACCGGTCTCAG
CTTTAAAGAAAGAAAAAAAAAAAAAAGAAAAAGCCTTAGTTTCCGACGCGCTGTAACGTGTATATATATCCACCA
CGTTGCCTACCCTCGCCCGCCTCCGCAGACTCATGCCTCCATCTTGGTACTGCTCAGCCATGAGGGTTTCGGTCG
TGGCGGTCGGTGTCCTACTGGGGGATCTGGCTGCGGCTTCGTCTTGGATTGGGCGACGGGGGGGGCAGGATGGGA
AAGGTGGTGGTGGTTCGATGGGGTTTGATGCTAGGGTTCAGCTTGTGTCGACGATGGGGGAGCATGCCTTTGTGA
GTTTTTTTTTTTTTTTACGGCTTGGTATTTTGTGTTTTTTTGTTTTGTTTCTTTTTCTGCATGTTGGGCTGATGA
AGATGTAGAAAGCTCCCGGGGCGTATGACCTCCGAGGGCCCTGTCCCGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail