Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06306
Gene name
Locationscaffold_07:1847516..1848706
Strand+
Gene length (bp)1190
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03770 IPK Inositol polyphosphate kinase 5.5E-51 133 372

GO

GO Term Description Terminal node
GO:0016301 kinase activity Yes
GO:0032958 inositol phosphate biosynthetic process Yes
GO:0046165 alcohol biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0006066 alcohol metabolic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0003824 catalytic activity No
GO:0044283 small molecule biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0003674 molecular_function No
GO:0090407 organophosphate biosynthetic process No
GO:0019751 polyol metabolic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043647 inositol phosphate metabolic process No
GO:0008150 biological_process No
GO:0006793 phosphorus metabolic process No
GO:0019637 organophosphate metabolic process No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0046173 polyol biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear export signal 0.4549 0.6589 0.0526 0.1231 0.1735 0.0047 0.1544 0.2225 0.0765 0.0049

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 26.24 12.67 39.81
Alive In ants, during behavior modification 51.50 27.97 75.03
Dead In ants, recently dead 27.97 13.44 42.50

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.001043 yes
Alive Dead 0.000238 yes
Dead Fungus 0.819162 no

Orthologs

Orthofinder run ID4
Orthogroup1649
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3638
Ophiocordyceps australis map64 (Brazil) OphauB2|5613
Ophiocordyceps camponoti-floridani Ophcf2|06306 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2267
Ophiocordyceps kimflemingae Ophio5|7326
Ophiocordyceps subramaniannii Hirsu2|1345

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06306
MGQRELPSRDELREYNYAVAGHAGTMCDADGELFIKPCTQSEIDFYQSAVRRHPEFAEVMPLFIGSLLLSDASAA
SIDKVVTGVISDTGDVKTTREQIVATVNEQVARAPVPPQDGVTWIPSKGKKIKTDKAIVLSNATHGFKHANVLDV
KLGVRLWADDAPQEKKRRFDKISAETTHQSLGFRIAGMRVFRGSTDSSDLDQEGYKRYDKEYGRLMVHDANVVDE
FRRFIFNEAAGIDKELGRAVCAAFARDLARIRDVMTRHETRMYSASLLFVFEGDGEALRSAIEENNAALESAATW
DTPDRSAQRYDSGIVLSDDDDDDDDDLEQLEASLPQIYSLKLIDFAHAQWTPGLGPDENMLKGVRSLERIFKEMA
Q*
Coding >Ophcf2|06306
ATGGGACAGCGTGAGCTGCCTAGTCGCGACGAGCTGCGCGAATACAACTACGCCGTTGCTGGACATGCCGGGACC
ATGTGTGATGCCGATGGCGAGCTCTTCATCAAACCCTGCACCCAGTCCGAGATAGACTTCTATCAATCTGCCGTC
CGCCGACACCCCGAATTCGCCGAAGTGATGCCCCTCTTTATAGGCTCCCTGCTCCTCAGCGATGCATCCGCCGCG
TCAATCGACAAGGTCGTTACCGGCGTCATATCCGATACCGGCGATGTCAAGACTACGAGAGAGCAGATTGTCGCC
ACCGTCAACGAGCAGGTTGCCCGCGCCCCCGTCCCGCCTCAGGATGGCGTCACCTGGATACCGTCCAAGGGCAAG
AAGATCAAGACGGACAAGGCCATCGTGCTCAGCAACGCCACCCACGGTTTCAAGCACGCCAACGTGCTCGACGTC
AAGCTCGGTGTGAGGCTATGGGCTGACGACGCGCCCCAGGAGAAGAAGCGACGGTTCGACAAGATTTCGGCCGAG
ACGACCCATCAAAGTCTGGGCTTTCGAATCGCCGGCATGCGTGTCTTTCGTGGATCTACAGATTCCTCGGACTTG
GACCAGGAAGGCTACAAGAGGTACGACAAGGAGTACGGACGCTTGATGGTCCACGACGCCAATGTCGTTGACGAG
TTTCGACGCTTCATCTTCAACGAAGCTGCCGGGATAGACAAGGAGCTGGGAAGAGCCGTCTGCGCGGCTTTTGCC
CGCGACTTGGCGAGAATTCGCGACGTCATGACAAGACATGAAACTCGCATGTACTCAGCTTCACTCCTCTTCGTC
TTCGAAGGCGATGGCGAAGCCCTACGGTCTGCCATCGAGGAGAACAACGCCGCCCTCGAGTCGGCCGCTACGTGG
GATACGCCGGATCGATCGGCTCAACGCTATGATAGTGGCATCGTTTTGAGCGACGACGACGACGACGACGACGAC
GATCTGGAACAGCTCGAGGCGTCGTTGCCACAGATCTACTCGCTGAAGCTGATCGACTTTGCCCACGCGCAGTGG
ACTCCTGGGCTGGGTCCGGACGAGAACATGCTCAAGGGCGTCAGGAGTCTGGAGCGGATCTTCAAGGAGATGGCG
CAATGA
Transcript >Ophcf2|06306
ATGGGACAGCGTGAGCTGCCTAGTCGCGACGAGCTGCGCGAATACAACTACGCCGTTGCTGGACATGCCGGGACC
ATGTGTGATGCCGATGGCGAGCTCTTCATCAAACCCTGCACCCAGTCCGAGATAGACTTCTATCAATCTGCCGTC
CGCCGACACCCCGAATTCGCCGAAGTGATGCCCCTCTTTATAGGCTCCCTGCTCCTCAGCGATGCATCCGCCGCG
TCAATCGACAAGGTCGTTACCGGCGTCATATCCGATACCGGCGATGTCAAGACTACGAGAGAGCAGATTGTCGCC
ACCGTCAACGAGCAGGTTGCCCGCGCCCCCGTCCCGCCTCAGGATGGCGTCACCTGGATACCGTCCAAGGGCAAG
AAGATCAAGACGGACAAGGCCATCGTGCTCAGCAACGCCACCCACGGTTTCAAGCACGCCAACGTGCTCGACGTC
AAGCTCGGTGTGAGGCTATGGGCTGACGACGCGCCCCAGGAGAAGAAGCGACGGTTCGACAAGATTTCGGCCGAG
ACGACCCATCAAAGTCTGGGCTTTCGAATCGCCGGCATGCGTGTCTTTCGTGGATCTACAGATTCCTCGGACTTG
GACCAGGAAGGCTACAAGAGGTACGACAAGGAGTACGGACGCTTGATGGTCCACGACGCCAATGTCGTTGACGAG
TTTCGACGCTTCATCTTCAACGAAGCTGCCGGGATAGACAAGGAGCTGGGAAGAGCCGTCTGCGCGGCTTTTGCC
CGCGACTTGGCGAGAATTCGCGACGTCATGACAAGACATGAAACTCGCATGTACTCAGCTTCACTCCTCTTCGTC
TTCGAAGGCGATGGCGAAGCCCTACGGTCTGCCATCGAGGAGAACAACGCCGCCCTCGAGTCGGCCGCTACGTGG
GATACGCCGGATCGATCGGCTCAACGCTATGATAGTGGCATCGTTTTGAGCGACGACGACGACGACGACGACGAC
GATCTGGAACAGCTCGAGGCGTCGTTGCCACAGATCTACTCGCTGAAGCTGATCGACTTTGCCCACGCGCAGTGG
ACTCCTGGGCTGGGTCCGGACGAGAACATGCTCAAGGGCGTCAGGAGTCTGGAGCGGATCTTCAAGGAGATGGCG
CAATGA
Gene >Ophcf2|06306
ATGGGACAGCGTGAGCTGCCTAGTCGCGACGAGCTGCGCGAATACAACTACGCCGTTGCTGGACAGTGAGTCTAC
CTACTTCCACTTCCACCCCATCCCTACGACCGCTGACTGGGACGTCTAGTGCCGGGACCATGTGTGATGCCGATG
GCGAGCTCTTCATCAAACCCTGCACCCAGTCCGAGATAGACTTCTATCAATCTGCCGTCCGCCGACACCCCGAAT
TCGCCGAAGTGATGCCCCTCTTTATAGGCTCCCTGCTCCTCAGCGATGCATCCGCCGCGTCAATCGACAAGGTCG
TTACCGGCGTCATATCCGATACCGGCGATGTCAAGACTACGAGAGAGCAGATTGTCGCCACCGTCAACGAGCAGG
TTGCCCGCGCCCCCGTCCCGCCTCAGGATGGCGTCACCTGGATACCGTCCAAGGGCAAGAAGATCAAGACGGACA
AGGCCATCGTGCTCAGCAACGCCACCCACGGTTTCAAGCACGCCAACGTGCTCGACGTCAAGCTCGGTGTGAGGC
TATGGGCTGACGACGCGCCCCAGGAGAAGAAGCGACGGTTCGACAAGATTTCGGCCGAGACGACCCATCAAAGTC
TGGGCTTTCGAATCGCCGGCATGCGTGTCTTTCGTGGATCTACAGATTCCTCGGACTTGGACCAGGAAGGCTACA
AGAGGTACGACAAGGAGTACGGACGCTTGATGGTCCACGACGCCAATGTCGTTGACGAGTTTCGACGCTTCATCT
TCAACGAAGCTGCCGGGATAGACAAGGAGCTGGGAAGAGCCGTCTGCGCGGCTTTTGCCCGCGACTTGGCGAGAA
TTCGCGACGTCATGACAAGACATGAAACTCGCATGTACTCAGCTTCACTCCTCTTCGTCTTCGAAGGCGATGGCG
AAGCCCTACGGTCTGCCATCGAGGAGAACAACGCCGCCCTCGAGTCGGCCGCTACGTGGGATACGCCGGATCGAT
CGGCTCAACGCTATGATAGTGGCATCGTTTTGAGCGACGACGACGACGACGACGACGACGATCTGGAACAGCTCG
AGGCGTCGTTGCCACAGATCTACTCGCTGAAGCTGATCGACTTTGCCCACGCGCAGTGGACTCCTGGGCTGGGTC
CGGACGAGAACATGCTCAAGGGCGTCAGGAGTCTGGAGCGGATCTTCAAGGAGATGGCGCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail