Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06300
Gene name
Locationscaffold_07:1831453..1833677
Strand+
Gene length (bp)2224
Transcript length (bp)1881
Coding sequence length (bp)1881
Protein length (aa) 627

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain 5.8E-12 116 222
PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2 6.1E-08 235 317
PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain 6.6E-07 359 481

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1945 0.1831 0.78 0.1552 0.1858 0.0847 0.2628 0.4021 0.247 0.05

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.999718

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH2 2.0E-95 63 495

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4559
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7657
Ophiocordyceps australis map64 (Brazil) OphauB2|554
Ophiocordyceps camponoti-floridani Ophcf2|06300 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5496
Ophiocordyceps kimflemingae Ophio5|7311
Ophiocordyceps subramaniannii Hirsu2|954

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06300
MDRLSRLLLPLLLLCQPGQTASSQALLNRAPIPYRAQTPPLDTPWTSKVGTDPWPEHPRPQLRRDAWHSLNGLWT
YRDAGTRTPRDGLPEAGPLDREVLIPSCIESALSGIQQLNTSRVWFETPFRVPGGWNGTSRVLLHFEAVDYEATV
FLDGVEVGRHVGGYFRFSIDLTGKVRAGEEHRLLVYVFDPTDTDVIPVGKQTKNPRHIWYRPCTGIWQTVWLESV
ASSDYISQLDVSADMTGLVTVQAHSSARKGAPVEVTVIDSDGRPLCKGTGKADSKFSFKVQAPKLWSPSTPHLYN
VSVVMGRDVVHSYTGFRTVSTGVVQGVQRPLLNGQFVFLFGTLDQGFWPDGLYTPPNREAMVYDLKMLKDLGFNM
VRKHIKVEPDLFYRACDEMGLMVIQDMPSLPDDQSRPPNDAQQAEFQRQLEILINEHKSYPSIVTWLIYNEGWGQ
RRQAPFPEGKLTDVVRGIDSTRLIDSASGWVDHGFGDFSDNHHYANPQCGSPFYSLASPPYDAKRIGFQGEFGGI
GHTPKIEHLWNVRQAIDTVNETYEINADLEAYNYRAGVLFRELREQVERYACSGGVWTQTTDVEGEVNGLYTYDR
RILRPDVGQWRGDIRRLYEAAARRAR*
Coding >Ophcf2|06300
ATGGATCGTCTATCCCGCTTACTGCTCCCCCTGCTACTCCTCTGTCAACCAGGCCAAACAGCGTCATCACAAGCT
CTCCTGAACCGCGCCCCAATCCCCTACCGAGCGCAGACACCACCCCTCGATACACCCTGGACATCCAAAGTCGGA
ACGGATCCTTGGCCAGAGCATCCACGACCACAGCTTCGTCGCGACGCCTGGCATAGCCTCAACGGGCTGTGGACG
TACCGCGATGCTGGCACCCGGACGCCGAGAGATGGCCTTCCCGAGGCGGGGCCGCTGGATCGTGAGGTGCTGATC
CCTTCGTGTATCGAGAGTGCGCTTTCCGGTATCCAGCAGCTTAATACCTCGCGGGTTTGGTTCGAGACGCCTTTC
CGTGTGCCGGGAGGGTGGAATGGGACGAGTAGGGTTTTGTTGCACTTTGAGGCTGTTGACTATGAAGCTACCGTC
TTTCTGGATGGGGTTGAGGTTGGGAGACATGTTGGGGGGTATTTCCGCTTCAGCATCGACCTGACCGGCAAGGTT
AGGGCTGGAGAGGAGCACAGACTTCTCGTCTACGTCTTTGATCCGACGGACACGGACGTCATCCCCGTTGGAAAG
CAGACCAAGAACCCTCGTCATATCTGGTACCGTCCCTGCACGGGAATCTGGCAGACTGTCTGGTTGGAGAGCGTC
GCGTCGTCGGATTACATCTCCCAGCTCGACGTATCGGCCGATATGACGGGCCTAGTTACAGTCCAAGCTCACAGC
TCAGCAAGAAAGGGAGCACCCGTCGAGGTGACCGTCATAGACTCGGACGGCAGACCTCTCTGCAAGGGCACGGGA
AAAGCAGACTCCAAGTTCAGCTTCAAGGTTCAGGCGCCGAAGCTGTGGAGTCCGTCGACGCCTCACCTGTACAAC
GTCAGCGTCGTCATGGGCCGGGACGTGGTCCATAGCTATACTGGCTTCCGGACGGTTTCTACGGGGGTGGTTCAG
GGGGTGCAGAGGCCGTTGCTCAATGGCCAGTTTGTGTTTTTGTTTGGAACGCTTGATCAGGGGTTTTGGCCGGAT
GGGTTGTATACGCCTCCCAATCGTGAGGCCATGGTTTATGACCTGAAGATGCTGAAGGATCTGGGCTTTAACATG
GTCAGGAAGCATATCAAAGTCGAACCGGATCTGTTCTACCGCGCGTGCGATGAGATGGGCTTGATGGTCATCCAA
GACATGCCCAGCCTCCCCGACGACCAGAGCCGCCCCCCCAACGACGCCCAACAAGCCGAGTTCCAGCGCCAGCTC
GAGATTCTAATCAACGAGCACAAGAGCTACCCCTCCATCGTCACCTGGCTGATTTACAACGAGGGTTGGGGACAG
CGTCGTCAGGCTCCCTTTCCGGAAGGCAAGCTCACCGACGTTGTTCGCGGGATCGATTCCACGAGGTTGATTGAC
TCTGCTTCTGGATGGGTGGATCATGGCTTTGGGGATTTCTCGGATAACCATCATTACGCTAATCCTCAGTGCGGC
TCTCCCTTTTACTCCCTCGCTTCTCCGCCCTACGACGCAAAACGGATCGGCTTCCAGGGTGAGTTCGGAGGCATA
GGCCACACGCCCAAAATAGAGCACCTCTGGAACGTCCGCCAAGCCATCGACACCGTCAACGAAACGTACGAAATC
AACGCCGACTTGGAAGCCTACAACTACCGCGCGGGCGTGCTCTTCCGCGAGCTACGCGAGCAGGTCGAGCGCTAT
GCCTGCAGCGGCGGCGTGTGGACGCAGACTACGGATGTCGAGGGCGAGGTCAATGGCTTGTACACTTATGATCGG
AGGATTTTGAGGCCGGATGTTGGGCAGTGGAGGGGGGATATCCGAAGGTTGTATGAGGCTGCTGCTAGGAGGGCG
AGGTAG
Transcript >Ophcf2|06300
ATGGATCGTCTATCCCGCTTACTGCTCCCCCTGCTACTCCTCTGTCAACCAGGCCAAACAGCGTCATCACAAGCT
CTCCTGAACCGCGCCCCAATCCCCTACCGAGCGCAGACACCACCCCTCGATACACCCTGGACATCCAAAGTCGGA
ACGGATCCTTGGCCAGAGCATCCACGACCACAGCTTCGTCGCGACGCCTGGCATAGCCTCAACGGGCTGTGGACG
TACCGCGATGCTGGCACCCGGACGCCGAGAGATGGCCTTCCCGAGGCGGGGCCGCTGGATCGTGAGGTGCTGATC
CCTTCGTGTATCGAGAGTGCGCTTTCCGGTATCCAGCAGCTTAATACCTCGCGGGTTTGGTTCGAGACGCCTTTC
CGTGTGCCGGGAGGGTGGAATGGGACGAGTAGGGTTTTGTTGCACTTTGAGGCTGTTGACTATGAAGCTACCGTC
TTTCTGGATGGGGTTGAGGTTGGGAGACATGTTGGGGGGTATTTCCGCTTCAGCATCGACCTGACCGGCAAGGTT
AGGGCTGGAGAGGAGCACAGACTTCTCGTCTACGTCTTTGATCCGACGGACACGGACGTCATCCCCGTTGGAAAG
CAGACCAAGAACCCTCGTCATATCTGGTACCGTCCCTGCACGGGAATCTGGCAGACTGTCTGGTTGGAGAGCGTC
GCGTCGTCGGATTACATCTCCCAGCTCGACGTATCGGCCGATATGACGGGCCTAGTTACAGTCCAAGCTCACAGC
TCAGCAAGAAAGGGAGCACCCGTCGAGGTGACCGTCATAGACTCGGACGGCAGACCTCTCTGCAAGGGCACGGGA
AAAGCAGACTCCAAGTTCAGCTTCAAGGTTCAGGCGCCGAAGCTGTGGAGTCCGTCGACGCCTCACCTGTACAAC
GTCAGCGTCGTCATGGGCCGGGACGTGGTCCATAGCTATACTGGCTTCCGGACGGTTTCTACGGGGGTGGTTCAG
GGGGTGCAGAGGCCGTTGCTCAATGGCCAGTTTGTGTTTTTGTTTGGAACGCTTGATCAGGGGTTTTGGCCGGAT
GGGTTGTATACGCCTCCCAATCGTGAGGCCATGGTTTATGACCTGAAGATGCTGAAGGATCTGGGCTTTAACATG
GTCAGGAAGCATATCAAAGTCGAACCGGATCTGTTCTACCGCGCGTGCGATGAGATGGGCTTGATGGTCATCCAA
GACATGCCCAGCCTCCCCGACGACCAGAGCCGCCCCCCCAACGACGCCCAACAAGCCGAGTTCCAGCGCCAGCTC
GAGATTCTAATCAACGAGCACAAGAGCTACCCCTCCATCGTCACCTGGCTGATTTACAACGAGGGTTGGGGACAG
CGTCGTCAGGCTCCCTTTCCGGAAGGCAAGCTCACCGACGTTGTTCGCGGGATCGATTCCACGAGGTTGATTGAC
TCTGCTTCTGGATGGGTGGATCATGGCTTTGGGGATTTCTCGGATAACCATCATTACGCTAATCCTCAGTGCGGC
TCTCCCTTTTACTCCCTCGCTTCTCCGCCCTACGACGCAAAACGGATCGGCTTCCAGGGTGAGTTCGGAGGCATA
GGCCACACGCCCAAAATAGAGCACCTCTGGAACGTCCGCCAAGCCATCGACACCGTCAACGAAACGTACGAAATC
AACGCCGACTTGGAAGCCTACAACTACCGCGCGGGCGTGCTCTTCCGCGAGCTACGCGAGCAGGTCGAGCGCTAT
GCCTGCAGCGGCGGCGTGTGGACGCAGACTACGGATGTCGAGGGCGAGGTCAATGGCTTGTACACTTATGATCGG
AGGATTTTGAGGCCGGATGTTGGGCAGTGGAGGGGGGATATCCGAAGGTTGTATGAGGCTGCTGCTAGGAGGGCG
AGGTAG
Gene >Ophcf2|06300
ATGGATCGTCTATCCCGCTTACTGCTCCCCCTGCTACTCCTCTGTCAACCAGGCCAAACAGCGTCATCACAAGCT
CTCCTGAACCGCGCCCCAATCCCCTACCGAGCGCAGACACCACCCCTCGATACACCCTGGACATCCAAAGTCGGA
ACGGATCCTTGGCCAGAGCATCCACGACCACAGCTTCGTCGCGACGCCTGGCATAGCCTCAACGGGCTGTGGACG
TACCGCGATGCTGGCACCCGGACGCCGAGAGATGGCCTTCCCGAGGCGGGGCCGCTGGATCGTGAGGTGCTGATC
CCTTCGTGTATCGAGAGTGCGCTTTCCGGTATCCAGCAGCTTAATACCTCGCGGGTTTGGTTCGAGACGCCTTTC
CGTGTGCCGGGAGGGTGGAATGGGACGAGTAGGGTTTTGTTGCACTTTGAGGCTGTTGACTATGAAGCTACCGTC
TTTCTGGATGGGGTTGAGGTTGGGAGACATGTTGGGGGGTATTTCCGCTTCAGCATCGACCTGACCGGCAAGGTT
AGGGCTGGAGAGGAGCACAGACTGTGAGTCTTTTCTTTTGTCGATGCTGAAGAGGTTATGATGGCTAACAAAGGT
ATAGTCTCGTCTACGTCTTTGATCCGACGGACACGGACGTCATCCCCGTTGGAAAGCAGACCAAGAACCCTCGTC
ATATCTGGTACCGTCCCTGCACGGGAATCTGGCAGACTGTCTGGTTGGAGAGCGTCGCGTCGTCGGATTACATCT
CCCAGCTCGACGTATCGGCCGATATGACGGGCCTAGTTACAGTCCAAGCTCACAGCTCAGCAAGAAAGGGAGCAC
CCGTCGAGGTGACCGTCATAGACTCGGACGGCAGACCTCTCTGCAAGGGCACGGGAAAAGCAGACTCCAAGTTCA
GCTTCAAGGTTCAGGCGCCGAAGCTGTGGAGTCCGTCGACGCCTCACCTGTACAACGTCAGCGTCGTCATGGGCC
GGGACGTGGTCCATAGCTATACTGGCTTCCGGACGGTTTCTACGGGGGTGGTTCAGGGGGTGCAGAGGCCGTTGC
TCAATGGCCAGTTTGTGTTTTTGTTTGGAACGCTTGATCAGGGGTTTTGGCCGGATGGGTTGTATACGCCTCCCA
ATCGTGAGGCCATGGTTTATGACCTGAAGATGCTGAAGGATCTGGGCTTTAACATGGTCAGGAAGCATGTGAGTT
TTTCTTTTGTTTTGTTTCTCCTATCCTATCGGCGTACATTATATCCCTTGATTCTGGTTACTTACACGCTGCAGA
TCAAAGTCGAACCGGATCTGTTCTACCGCGCGTGCGATGAGATGGGCTTGATGGTCATCCAAGACATGCCCAGCC
TCCCCGACGACCAGAGCCGCCCCCCCAACGACGCCCAACAAGCCGAGTTCCAGCGCCAGCTCGAGATTCTAATCA
ACGAGCACAAGAGCTACCCCTCCATCGTCACCTGGGTGAGAAAGCCTCCCCCATTCATCATCATCACCATCACCA
TGAAGCAGCAGAGACGGAGATCAATCATATTTGCTGACTGGCGTTTGGGGGGTTTAGCTGATTTACAACGAGGGT
TGGGGACAGCGTCGTCAGGCTCCCTTTCCGGAAGGCAAGCTCACCGACGTTGTTCGCGGGATCGATTCCACGAGG
TTGATTGACTCTGCTTCTGGATGGGTGGATCATGGCTTTGGGGATTTCTCGGTAGGACTCTTCGGGTTATGATGG
AGCTGTCAAGGGGAAACTAACGAATGTGGTGAAGGATAACCATCATTACGCTAATCCTCAGTGCGGCTCTCCCTT
TTACTCCCTCGCTTCTCCGCCCTACGACGCAAAACGGATCGGCTTCCAGGGTGAGTTCGGAGGCATAGGCCACAC
GCCCAAAATAGAGCAGTGAGTTCCCCCGTGCCGATGACGAGAGGACAGCATCTAAGCAACCAGCAGCCTCTGGAA
CGTCCGCCAAGCCATCGACACCGTCAACGAAACGTACGAAATCAACGCCGACTTGGAAGCCTACAACTACCGCGC
GGGCGTGCTCTTCCGCGAGCTACGCGAGCAGGTCGAGCGCTATGCCTGCAGCGGCGGCGTGTGGACGCAGACTAC
GGATGTCGAGGGCGAGGTCAATGGCTTGTACACTTATGATCGGAGGATTTTGAGGCCGGATGTTGGGCAGTGGAG
GGGGGATATCCGAAGGTTGTATGAGGCTGCTGCTAGGAGGGCGAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail