Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06296
Gene name
Locationscaffold_07:1820586..1821009
Strand-
Gene length (bp)423
Transcript length (bp)423
Coding sequence length (bp)423
Protein length (aa) 141

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular|Cell membrane 0.07 0.0706 0.7198 0.57 0.0896 0.0032 0.1912 0.067 0.0696 0.0041

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4587
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3198
Ophiocordyceps australis map64 (Brazil) OphauB2|546
Ophiocordyceps camponoti-floridani Ophcf2|06296 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2620
Ophiocordyceps kimflemingae Ophio5|7307
Ophiocordyceps subramaniannii Hirsu2|963

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06296
MPMLQARGTILPRETATPTVSGISEECLMAAESVLGTAPSPPPDVQSAILKNPQTNPCDFSTPQSLTSQFSSYSS
LLASWASSNENKLTACSDLSTLGALTDCNRDQATSTRSGNLAARPTGYAVAACAAAAAGFAAVAL*
Coding >Ophcf2|06296
ATGCCCATGCTCCAAGCACGCGGTACCATCCTCCCGCGAGAGACAGCCACGCCCACCGTCAGCGGCATCTCGGAA
GAGTGCCTCATGGCGGCCGAGTCGGTTCTCGGAACGGCGCCGTCACCGCCGCCAGACGTCCAGTCAGCCATCCTG
AAGAATCCGCAGACGAATCCTTGCGACTTCTCGACGCCTCAAAGCCTCACCAGCCAGTTCAGCTCCTACAGCTCC
CTACTCGCCTCCTGGGCCTCGTCCAACGAGAATAAGCTTACGGCTTGCTCCGATCTGTCTACCCTCGGCGCTCTG
ACCGACTGCAATAGGGATCAGGCTACAAGCACTCGCTCCGGCAACCTGGCGGCCCGTCCGACGGGATATGCTGTC
GCTGCCTGTGCTGCTGCCGCCGCTGGATTCGCCGCTGTTGCCTTGTAG
Transcript >Ophcf2|06296
ATGCCCATGCTCCAAGCACGCGGTACCATCCTCCCGCGAGAGACAGCCACGCCCACCGTCAGCGGCATCTCGGAA
GAGTGCCTCATGGCGGCCGAGTCGGTTCTCGGAACGGCGCCGTCACCGCCGCCAGACGTCCAGTCAGCCATCCTG
AAGAATCCGCAGACGAATCCTTGCGACTTCTCGACGCCTCAAAGCCTCACCAGCCAGTTCAGCTCCTACAGCTCC
CTACTCGCCTCCTGGGCCTCGTCCAACGAGAATAAGCTTACGGCTTGCTCCGATCTGTCTACCCTCGGCGCTCTG
ACCGACTGCAATAGGGATCAGGCTACAAGCACTCGCTCCGGCAACCTGGCGGCCCGTCCGACGGGATATGCTGTC
GCTGCCTGTGCTGCTGCCGCCGCTGGATTCGCCGCTGTTGCCTTGTAG
Gene >Ophcf2|06296
ATGCCCATGCTCCAAGCACGCGGTACCATCCTCCCGCGAGAGACAGCCACGCCCACCGTCAGCGGCATCTCGGAA
GAGTGCCTCATGGCGGCCGAGTCGGTTCTCGGAACGGCGCCGTCACCGCCGCCAGACGTCCAGTCAGCCATCCTG
AAGAATCCGCAGACGAATCCTTGCGACTTCTCGACGCCTCAAAGCCTCACCAGCCAGTTCAGCTCCTACAGCTCC
CTACTCGCCTCCTGGGCCTCGTCCAACGAGAATAAGCTTACGGCTTGCTCCGATCTGTCTACCCTCGGCGCTCTG
ACCGACTGCAATAGGGATCAGGCTACAAGCACTCGCTCCGGCAACCTGGCGGCCCGTCCGACGGGATATGCTGTC
GCTGCCTGTGCTGCTGCCGCCGCTGGATTCGCCGCTGTTGCCTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail