Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06290
Gene name
Locationscaffold_07:1802760..1804890
Strand-
Gene length (bp)2130
Transcript length (bp)2064
Coding sequence length (bp)2064
Protein length (aa) 688

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14661 HAUS6_N HAUS augmin-like complex subunit 6 N-terminus 2.4E-39 40 273

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal|Nuclear export signal 0.7896 0.488 0.0613 0.1074 0.0884 0.0031 0.0821 0.0964 0.1577 0.008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1020
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3790
Ophiocordyceps australis map64 (Brazil) OphauB2|537
Ophiocordyceps camponoti-floridani Ophcf2|06290 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2614
Ophiocordyceps kimflemingae Ophio5|7301
Ophiocordyceps subramaniannii Hirsu2|9216
Ophiocordyceps subramaniannii Hirsu2|9217

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06290
MASHQHARTRSAASLSRPQERRLQGGGPTNGFVKTNIPIFLTNLRLLDLDLRPDWPHIKADMFEANTSLKREKRV
ECVEWVLFHLFSLLDPDEAAAKLKPYFPPSGQSESLSLRVGLLRALEGAKRSGLLGRECVIRKTMLDDCRGDRFE
EVLAYISTAALKAKVARDKRKAACRLPTAFSSALETEDVMEFLLFPLELSYRVSLCRLLARKEAAQVRYVWLARE
ITTKERSLAESEKSIQLREQDRVYFYKTCDTDLEDDMAEIHRKIDKNWSDNEGWKDAILGRFGGTVNRGIVARPF
DAVWRGLQEGRTSELADDGKGLTENLEGRIRVLEERVKRWQAFRDEIVGTRHEAKQLIPKDPDSGSPAMGLDLSF
REHESLQVRNMNDVDVAPGLERRHNPLNHADDEARQHCTRLQMVLDKLKHRVKTPHTHPYHHMMHARPSTSVLPP
PSGVCCPDRQSSDDVHLSEPRPCGLEPVEEKYWSGARTSRSSSGCSSPTRQPKQAEKPVAKGSTPYERWPLKEPL
EPAKPDLRPVNHAKTLEDKPDAPRHTLSLSERTCLSMSRTDGNASLQEPEPEPGPAPKPAEEDEPTAAIDDLINR
TRRSMAGFEKAQQKAKLERRRSERKARMSPRKESALYPTPEEGSEQTAASTLDPGDEDDVEAVFRSRPKVMASPI
ASPMREGRGEDE*
Coding >Ophcf2|06290
ATGGCGTCGCATCAGCACGCCCGGACGCGCTCGGCGGCTTCCCTGTCCAGGCCTCAAGAGCGCCGTCTCCAAGGT
GGCGGCCCTACCAATGGTTTCGTCAAGACGAATATACCCATCTTCCTGACGAATCTGCGGCTGCTCGACCTCGAC
CTGCGACCGGACTGGCCTCACATCAAGGCTGACATGTTCGAGGCAAACACCTCGCTGAAGAGGGAGAAAAGGGTG
GAGTGTGTGGAATGGGTCTTGTTTCACCTCTTTTCCCTGCTGGACCCTGATGAGGCGGCAGCGAAACTGAAGCCA
TACTTTCCGCCGTCTGGTCAGTCAGAGTCTCTCAGCCTTCGCGTCGGCCTTTTGCGAGCGCTCGAGGGAGCCAAG
CGGAGCGGCCTGCTGGGACGCGAGTGTGTCATTCGCAAGACGATGCTGGACGACTGCCGGGGAGACAGATTCGAG
GAAGTCCTCGCTTATATCTCCACGGCGGCACTAAAGGCCAAGGTCGCCCGAGACAAGAGAAAAGCGGCCTGTCGG
TTGCCCACGGCCTTCAGTTCCGCACTCGAGACTGAGGACGTTATGGAATTCTTGCTCTTTCCGCTGGAATTGTCG
TATCGAGTATCTCTCTGTCGTCTCCTCGCGCGAAAGGAGGCAGCACAAGTTCGCTACGTGTGGTTAGCTCGAGAA
ATTACCACCAAGGAGCGATCCTTGGCTGAAAGTGAAAAATCAATTCAACTCCGAGAGCAGGATCGCGTCTATTTC
TATAAGACCTGTGACACCGATTTGGAGGATGACATGGCGGAGATTCACCGCAAGATTGATAAGAATTGGTCCGAC
AACGAAGGCTGGAAAGACGCTATTCTTGGCCGCTTCGGCGGTACAGTGAATCGTGGTATTGTGGCGAGGCCTTTT
GACGCGGTGTGGCGCGGACTTCAAGAGGGTCGGACTTCGGAGCTTGCAGATGACGGAAAAGGCCTCACGGAGAAT
CTCGAAGGTCGGATTCGGGTGCTGGAAGAGAGGGTGAAGAGGTGGCAGGCTTTCCGCGATGAGATTGTCGGTACC
CGACATGAGGCCAAGCAGCTGATTCCTAAAGATCCGGATTCTGGCAGCCCTGCGATGGGGCTGGATCTCAGCTTT
CGCGAGCACGAATCACTCCAGGTCCGAAACATGAACGATGTTGATGTTGCTCCCGGCCTTGAACGGCGTCACAAT
CCTCTCAATCACGCTGACGACGAGGCTCGACAACACTGCACACGTCTACAGATGGTGTTGGACAAGCTCAAGCAT
CGGGTGAAGACTCCACATACTCATCCTTATCATCACATGATGCACGCCCGGCCTTCCACGTCTGTGCTGCCACCG
CCGTCTGGCGTATGCTGTCCAGACCGACAGAGCTCAGATGACGTGCACTTATCGGAACCCAGACCTTGCGGCTTG
GAGCCTGTCGAGGAGAAGTACTGGTCGGGAGCCCGTACGTCGAGGAGCTCTTCGGGCTGCTCATCACCGACGCGT
CAGCCAAAACAGGCGGAGAAGCCCGTCGCGAAGGGGTCGACACCATACGAGAGATGGCCATTAAAAGAGCCCCTA
GAACCCGCCAAGCCAGATCTCAGGCCCGTCAATCACGCAAAGACTCTGGAAGACAAGCCAGACGCACCCCGCCAT
ACCCTCTCTCTCTCGGAGCGCACCTGTCTCTCCATGTCACGCACCGACGGCAACGCATCTCTTCAAGAGCCAGAG
CCAGAGCCAGGTCCAGCCCCAAAGCCTGCGGAAGAGGACGAGCCCACAGCTGCCATCGACGACCTCATCAACCGC
ACGCGGCGCAGCATGGCGGGCTTCGAAAAGGCGCAGCAGAAGGCGAAGCTCGAGCGGCGTCGGTCTGAGAGGAAG
GCTAGGATGTCGCCGCGGAAGGAGAGCGCGCTGTATCCTACGCCCGAGGAGGGGTCGGAGCAGACGGCTGCCTCG
ACGCTGGATCCGGGGGATGAGGATGATGTGGAGGCGGTGTTTCGGTCGAGGCCAAAGGTTATGGCGAGTCCGATA
GCGAGTCCGATGCGGGAGGGGAGGGGGGAGGACGAGTAG
Transcript >Ophcf2|06290
ATGGCGTCGCATCAGCACGCCCGGACGCGCTCGGCGGCTTCCCTGTCCAGGCCTCAAGAGCGCCGTCTCCAAGGT
GGCGGCCCTACCAATGGTTTCGTCAAGACGAATATACCCATCTTCCTGACGAATCTGCGGCTGCTCGACCTCGAC
CTGCGACCGGACTGGCCTCACATCAAGGCTGACATGTTCGAGGCAAACACCTCGCTGAAGAGGGAGAAAAGGGTG
GAGTGTGTGGAATGGGTCTTGTTTCACCTCTTTTCCCTGCTGGACCCTGATGAGGCGGCAGCGAAACTGAAGCCA
TACTTTCCGCCGTCTGGTCAGTCAGAGTCTCTCAGCCTTCGCGTCGGCCTTTTGCGAGCGCTCGAGGGAGCCAAG
CGGAGCGGCCTGCTGGGACGCGAGTGTGTCATTCGCAAGACGATGCTGGACGACTGCCGGGGAGACAGATTCGAG
GAAGTCCTCGCTTATATCTCCACGGCGGCACTAAAGGCCAAGGTCGCCCGAGACAAGAGAAAAGCGGCCTGTCGG
TTGCCCACGGCCTTCAGTTCCGCACTCGAGACTGAGGACGTTATGGAATTCTTGCTCTTTCCGCTGGAATTGTCG
TATCGAGTATCTCTCTGTCGTCTCCTCGCGCGAAAGGAGGCAGCACAAGTTCGCTACGTGTGGTTAGCTCGAGAA
ATTACCACCAAGGAGCGATCCTTGGCTGAAAGTGAAAAATCAATTCAACTCCGAGAGCAGGATCGCGTCTATTTC
TATAAGACCTGTGACACCGATTTGGAGGATGACATGGCGGAGATTCACCGCAAGATTGATAAGAATTGGTCCGAC
AACGAAGGCTGGAAAGACGCTATTCTTGGCCGCTTCGGCGGTACAGTGAATCGTGGTATTGTGGCGAGGCCTTTT
GACGCGGTGTGGCGCGGACTTCAAGAGGGTCGGACTTCGGAGCTTGCAGATGACGGAAAAGGCCTCACGGAGAAT
CTCGAAGGTCGGATTCGGGTGCTGGAAGAGAGGGTGAAGAGGTGGCAGGCTTTCCGCGATGAGATTGTCGGTACC
CGACATGAGGCCAAGCAGCTGATTCCTAAAGATCCGGATTCTGGCAGCCCTGCGATGGGGCTGGATCTCAGCTTT
CGCGAGCACGAATCACTCCAGGTCCGAAACATGAACGATGTTGATGTTGCTCCCGGCCTTGAACGGCGTCACAAT
CCTCTCAATCACGCTGACGACGAGGCTCGACAACACTGCACACGTCTACAGATGGTGTTGGACAAGCTCAAGCAT
CGGGTGAAGACTCCACATACTCATCCTTATCATCACATGATGCACGCCCGGCCTTCCACGTCTGTGCTGCCACCG
CCGTCTGGCGTATGCTGTCCAGACCGACAGAGCTCAGATGACGTGCACTTATCGGAACCCAGACCTTGCGGCTTG
GAGCCTGTCGAGGAGAAGTACTGGTCGGGAGCCCGTACGTCGAGGAGCTCTTCGGGCTGCTCATCACCGACGCGT
CAGCCAAAACAGGCGGAGAAGCCCGTCGCGAAGGGGTCGACACCATACGAGAGATGGCCATTAAAAGAGCCCCTA
GAACCCGCCAAGCCAGATCTCAGGCCCGTCAATCACGCAAAGACTCTGGAAGACAAGCCAGACGCACCCCGCCAT
ACCCTCTCTCTCTCGGAGCGCACCTGTCTCTCCATGTCACGCACCGACGGCAACGCATCTCTTCAAGAGCCAGAG
CCAGAGCCAGGTCCAGCCCCAAAGCCTGCGGAAGAGGACGAGCCCACAGCTGCCATCGACGACCTCATCAACCGC
ACGCGGCGCAGCATGGCGGGCTTCGAAAAGGCGCAGCAGAAGGCGAAGCTCGAGCGGCGTCGGTCTGAGAGGAAG
GCTAGGATGTCGCCGCGGAAGGAGAGCGCGCTGTATCCTACGCCCGAGGAGGGGTCGGAGCAGACGGCTGCCTCG
ACGCTGGATCCGGGGGATGAGGATGATGTGGAGGCGGTGTTTCGGTCGAGGCCAAAGGTTATGGCGAGTCCGATA
GCGAGTCCGATGCGGGAGGGGAGGGGGGAGGACGAGTAG
Gene >Ophcf2|06290
ATGGCGTCGCATCAGCACGCCCGGACGCGCTCGGCGGCTTCCCTGTCCAGGCCTCAAGAGCGCCGTCTCCAAGGT
GGCGGCCCTACCAATGGTTTCGTCAAGACGAATATACCCATCTTCCTGACGAATCTGCGGCTGCTCGACCTCGAC
CTGCGACCGGACTGGCCTCACATCAAGGCTGACATGTTCGAGGCAAACACCTCGCTGAAGAGGGAGAAAAGGGTG
GAGTGTGTGGAATGGGTCTTGTTTCACCTCTTTTCCCTGCTGGACCCTGATGAGGCGGCAGCGGTAGGGATATCG
CCATTTGCTGGTTCTGCTTGGACTTCTGCTGACCAGTATTGTCGTCTTTTACAGAAACTGAAGCCATACTTTCCG
CCGTCTGGTCAGTCAGAGTCTCTCAGCCTTCGCGTCGGCCTTTTGCGAGCGCTCGAGGGAGCCAAGCGGAGCGGC
CTGCTGGGACGCGAGTGTGTCATTCGCAAGACGATGCTGGACGACTGCCGGGGAGACAGATTCGAGGAAGTCCTC
GCTTATATCTCCACGGCGGCACTAAAGGCCAAGGTCGCCCGAGACAAGAGAAAAGCGGCCTGTCGGTTGCCCACG
GCCTTCAGTTCCGCACTCGAGACTGAGGACGTTATGGAATTCTTGCTCTTTCCGCTGGAATTGTCGTATCGAGTA
TCTCTCTGTCGTCTCCTCGCGCGAAAGGAGGCAGCACAAGTTCGCTACGTGTGGTTAGCTCGAGAAATTACCACC
AAGGAGCGATCCTTGGCTGAAAGTGAAAAATCAATTCAACTCCGAGAGCAGGATCGCGTCTATTTCTATAAGACC
TGTGACACCGATTTGGAGGATGACATGGCGGAGATTCACCGCAAGATTGATAAGAATTGGTCCGACAACGAAGGC
TGGAAAGACGCTATTCTTGGCCGCTTCGGCGGTACAGTGAATCGTGGTATTGTGGCGAGGCCTTTTGACGCGGTG
TGGCGCGGACTTCAAGAGGGTCGGACTTCGGAGCTTGCAGATGACGGAAAAGGCCTCACGGAGAATCTCGAAGGT
CGGATTCGGGTGCTGGAAGAGAGGGTGAAGAGGTGGCAGGCTTTCCGCGATGAGATTGTCGGTACCCGACATGAG
GCCAAGCAGCTGATTCCTAAAGATCCGGATTCTGGCAGCCCTGCGATGGGGCTGGATCTCAGCTTTCGCGAGCAC
GAATCACTCCAGGTCCGAAACATGAACGATGTTGATGTTGCTCCCGGCCTTGAACGGCGTCACAATCCTCTCAAT
CACGCTGACGACGAGGCTCGACAACACTGCACACGTCTACAGATGGTGTTGGACAAGCTCAAGCATCGGGTGAAG
ACTCCACATACTCATCCTTATCATCACATGATGCACGCCCGGCCTTCCACGTCTGTGCTGCCACCGCCGTCTGGC
GTATGCTGTCCAGACCGACAGAGCTCAGATGACGTGCACTTATCGGAACCCAGACCTTGCGGCTTGGAGCCTGTC
GAGGAGAAGTACTGGTCGGGAGCCCGTACGTCGAGGAGCTCTTCGGGCTGCTCATCACCGACGCGTCAGCCAAAA
CAGGCGGAGAAGCCCGTCGCGAAGGGGTCGACACCATACGAGAGATGGCCATTAAAAGAGCCCCTAGAACCCGCC
AAGCCAGATCTCAGGCCCGTCAATCACGCAAAGACTCTGGAAGACAAGCCAGACGCACCCCGCCATACCCTCTCT
CTCTCGGAGCGCACCTGTCTCTCCATGTCACGCACCGACGGCAACGCATCTCTTCAAGAGCCAGAGCCAGAGCCA
GGTCCAGCCCCAAAGCCTGCGGAAGAGGACGAGCCCACAGCTGCCATCGACGACCTCATCAACCGCACGCGGCGC
AGCATGGCGGGCTTCGAAAAGGCGCAGCAGAAGGCGAAGCTCGAGCGGCGTCGGTCTGAGAGGAAGGCTAGGATG
TCGCCGCGGAAGGAGAGCGCGCTGTATCCTACGCCCGAGGAGGGGTCGGAGCAGACGGCTGCCTCGACGCTGGAT
CCGGGGGATGAGGATGATGTGGAGGCGGTGTTTCGGTCGAGGCCAAAGGTTATGGCGAGTCCGATAGCGAGTCCG
ATGCGGGAGGGGAGGGGGGAGGACGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail