Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06284
Gene name
Locationscaffold_07:1783448..1784995
Strand+
Gene length (bp)1547
Transcript length (bp)1137
Coding sequence length (bp)1137
Protein length (aa) 379

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00782 DSPc Dual specificity phosphatase, catalytic domain 4.8E-09 185 248

GO

GO Term Description Terminal node
GO:0016311 dephosphorylation Yes
GO:0008138 protein tyrosine/serine/threonine phosphatase activity Yes
GO:0006796 phosphate-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016791 phosphatase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No
GO:0004721 phosphoprotein phosphatase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 204 226 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 51.14 28.15 74.14
Alive In ants, during behavior modification 95.90 54.74 137.07
Dead In ants, recently dead 71.94 40.72 103.16

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000454 yes
Alive Dead 0.075776 no
Dead Fungus 0.071192 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06284
MDVDLAMDDGEGECCAGPPPDAIRMAPYSLRAPSPPVLHVPVVQFRPDEPSEMRFTPSAERVDPTQLTDEDLFII
TGGKTHVAVDRVFSWRYEDRRRAQHILDFLVLGPTSVVRDDEFLRREAVTMMLVARDARMGDTRLVSVDVAASRH
GIVRLFVDVEYPSGVINAWSHAVRLINDHLVSYHRARGRRGKVLVMCESGNDRSAAIVVAYLMALFGVGVVPAIQ
FTSVQRFCCCFEEDVKRLLVAWGDILRARRAVAGQTFPRDAWQQQQQQQQLLSPQMQGQDGSWPAPSPLPPTEVA
VLPEAKAKRGLDDGMEDVCIVLVGERDGWCFKQRIAATFAIQWRNLAIVLGKIEENFSLLSLSGRTDVRLDWIEA
CVS*
Coding >Ophcf2|06284
ATGGACGTCGACTTGGCAATGGACGACGGCGAAGGGGAATGCTGCGCCGGTCCACCGCCGGACGCGATCCGTATG
GCGCCCTACTCGCTTCGCGCCCCCAGTCCGCCGGTCTTACACGTGCCGGTGGTGCAATTCAGGCCAGACGAGCCT
TCTGAGATGCGGTTCACGCCGTCGGCTGAGCGGGTTGATCCGACGCAGCTGACGGATGAAGACTTATTCATCATC
ACGGGGGGGAAGACGCACGTTGCCGTGGATCGCGTCTTCTCGTGGCGGTACGAGGATAGGCGTAGGGCTCAGCAT
ATACTCGACTTTCTCGTCCTCGGTCCTACGAGTGTTGTGCGCGATGACGAGTTCCTAAGGCGGGAGGCCGTTACC
ATGATGCTTGTTGCTCGTGATGCTCGCATGGGGGATACGAGACTTGTCAGCGTCGACGTGGCGGCCTCACGGCAT
GGCATCGTCAGACTCTTCGTTGACGTCGAGTACCCGTCTGGCGTCATCAACGCCTGGTCACATGCCGTCCGGCTC
ATCAACGACCACCTCGTCAGCTACCACCGCGCCCGCGGTCGACGCGGAAAGGTGCTCGTCATGTGCGAGTCCGGC
AATGACCGATCAGCAGCCATAGTGGTCGCCTACCTCATGGCTCTATTTGGCGTGGGAGTCGTGCCGGCGATACAG
TTCACCAGCGTGCAGCGTTTCTGCTGCTGCTTCGAGGAGGATGTCAAGAGGCTGCTGGTTGCGTGGGGGGATATC
CTGAGGGCTCGGCGGGCGGTGGCTGGTCAGACTTTCCCTCGTGACGCGTGGCAGCAGCAGCAGCAGCAGCAGCAG
CTTTTATCGCCGCAGATGCAGGGACAGGATGGGTCTTGGCCTGCTCCTTCGCCGTTGCCGCCGACGGAGGTTGCT
GTTCTTCCCGAGGCCAAGGCTAAGCGTGGGCTGGATGATGGCATGGAGGACGTCTGCATCGTCTTGGTTGGTGAG
CGAGATGGCTGGTGTTTCAAGCAGCGTATTGCTGCGACCTTTGCAATCCAATGGAGGAATCTTGCTATTGTCCTC
GGCAAAATAGAGGAGAATTTTTCACTATTGTCTCTCTCTGGCCGCACTGACGTTAGACTCGACTGGATCGAGGCG
TGCGTCAGTTGA
Transcript >Ophcf2|06284
ATGGACGTCGACTTGGCAATGGACGACGGCGAAGGGGAATGCTGCGCCGGTCCACCGCCGGACGCGATCCGTATG
GCGCCCTACTCGCTTCGCGCCCCCAGTCCGCCGGTCTTACACGTGCCGGTGGTGCAATTCAGGCCAGACGAGCCT
TCTGAGATGCGGTTCACGCCGTCGGCTGAGCGGGTTGATCCGACGCAGCTGACGGATGAAGACTTATTCATCATC
ACGGGGGGGAAGACGCACGTTGCCGTGGATCGCGTCTTCTCGTGGCGGTACGAGGATAGGCGTAGGGCTCAGCAT
ATACTCGACTTTCTCGTCCTCGGTCCTACGAGTGTTGTGCGCGATGACGAGTTCCTAAGGCGGGAGGCCGTTACC
ATGATGCTTGTTGCTCGTGATGCTCGCATGGGGGATACGAGACTTGTCAGCGTCGACGTGGCGGCCTCACGGCAT
GGCATCGTCAGACTCTTCGTTGACGTCGAGTACCCGTCTGGCGTCATCAACGCCTGGTCACATGCCGTCCGGCTC
ATCAACGACCACCTCGTCAGCTACCACCGCGCCCGCGGTCGACGCGGAAAGGTGCTCGTCATGTGCGAGTCCGGC
AATGACCGATCAGCAGCCATAGTGGTCGCCTACCTCATGGCTCTATTTGGCGTGGGAGTCGTGCCGGCGATACAG
TTCACCAGCGTGCAGCGTTTCTGCTGCTGCTTCGAGGAGGATGTCAAGAGGCTGCTGGTTGCGTGGGGGGATATC
CTGAGGGCTCGGCGGGCGGTGGCTGGTCAGACTTTCCCTCGTGACGCGTGGCAGCAGCAGCAGCAGCAGCAGCAG
CTTTTATCGCCGCAGATGCAGGGACAGGATGGGTCTTGGCCTGCTCCTTCGCCGTTGCCGCCGACGGAGGTTGCT
GTTCTTCCCGAGGCCAAGGCTAAGCGTGGGCTGGATGATGGCATGGAGGACGTCTGCATCGTCTTGGTTGGTGAG
CGAGATGGCTGGTGTTTCAAGCAGCGTATTGCTGCGACCTTTGCAATCCAATGGAGGAATCTTGCTATTGTCCTC
GGCAAAATAGAGGAGAATTTTTCACTATTGTCTCTCTCTGGCCGCACTGACGTTAGACTCGACTGGATCGAGGCG
TGCGTCAGTTGA
Gene >Ophcf2|06284
ATGGACGTCGACTTGGCAATGGACGACGGCGAAGGGGAATGCTGCGCCGGTCCACCGCCGGACGCGATCCGTATG
GCGCCCTACTCGCTTCGCGCCCCCAGTCCGCCGGTCTTACACGTGCCGGTGGTGCAATTCAGGCCAGACGAGCCT
TCTGAGATGCGGTTCACGCCGTCGGCTGAGCGGGTTGATCCGACGCAGCTGACGGATGAAGACTTATTCATCATC
ACGGGGGGGAAGACGCACGTTGCCGTGGATCGCGTCTTCTCGTGGCGGTACGAGGATAGGCGTAGGGCTCAGCAT
ATACTCGACTTTCTCGTCCTCGGTCCTACGAGTGTTGTGCGCGATGACGAGTTCCTAAGGCGGGAGGCCGTTACC
ATGATGCTTGTTGCTCGTGATGCTCGCATGGGGGATACGAGACTTGTCAGCGTCGACGTGGCGGCCTCACGGCAT
GGCATCGTCAGACTCTTCGTTGACGTCGAGTACCCGTCTGGCGTCATCAACGCCTGGTCACATGCCGTCCGGCTC
ATCAACGACCACCTCGTCAGCTACCACCGCGCCCGCGGTCGACGCGGAAAGGTGCTCGTCATGTGCGAGTCCGGC
AATGACCGATCAGCAGCCATAGTGGTCGCCTACCTCATGGCTCTATTTGGCGTGGGAGTCGTGCCGGCGATACAG
TTCACCAGCGTGCAGCGTTTCTGCTGCTGCTTCGAGGAGGATGTCAAGAGGCTGCTGGTTGCGTGGGGGGATATC
CTGAGGGCTCGGCGGGCGGTGGCTGGTCAGACTTTCCCTCGTGACGCGTGGCAGCAGCAGCAGCAGCAGCAGCAG
CTTTTATCGCCGCAGATGCAGGGACAGGATGGGTCTTGGCCTGCTCCTTCGCCGTTGCCGCCGACGGAGGTTGCT
GTTCTTCCCGAGGCCAAGGCTAAGCGTGGGCTGGATGATGGCATGGAGGACGGTGAGCGCTTCGTTGGGCGCGGA
TACTCGGCTCCTTTTGGTGACGTGTGTTGAATGTGAGGGGCGACGAGATGAAGGGGAGGTGGAGGGAGTCGGGAG
ATGCAGGTGAGTTTTGGTTCAAGGCAAAGCTTGAATCAGCAACTTGAATGGGCGCAGTCTGCATCGTCTTGGTTG
GTGAGCGAGATGGCTGGTGTTTCAAGGTAGGATCGGGACCCGCGAAGAAGCAGGTGAAGATGGCTTCATTGACTC
GAGTTATCTTGCTAGGTAGGTACTTGCGAGTATTCCATCAGCCATCTGTACTGCCATTGACTTGCTTGACTGGAT
GGAAGCAGCGTATTGCTGCGACCTTTGCAATGTGAGGCTTCAGTGCAGCGTGGGCTGTGATTGGCTGCCCACCGA
GGACACCAATCGAAGCCAATGGAGGAATCTTGCTATTGTCCTCGGCAAAATAGAGGAGAATTTTTCACTATTGTC
TCTCTCTGGCCGCACTGGTATAAATTTCTCTCTTCCCCCTCTTTCCTTTCGTCTCGTCTCTTCTTCTGACGTTGA
GAACATCAGACGTTAGACTCGACTGGATCGAGGCGTGCGTCAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail