Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06280
Gene name
Locationscaffold_07:1774151..1775748
Strand-
Gene length (bp)1597
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09139 Tam41_Mmp37 Phosphatidate cytidylyltransferase, mitochondrial 1.5E-117 119 492

GO

GO Term Description Terminal node
GO:0032049 cardiolipin biosynthetic process Yes
GO:0004605 phosphatidate cytidylyltransferase activity Yes
GO:0008654 phospholipid biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0046486 glycerolipid metabolic process No
GO:0003824 catalytic activity No
GO:0032048 cardiolipin metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0016740 transferase activity No
GO:0044255 cellular lipid metabolic process No
GO:0008152 metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:0009987 cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0070567 cytidylyltransferase activity No
GO:0003674 molecular_function No
GO:0090407 organophosphate biosynthetic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0008610 lipid biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0006655 phosphatidylglycerol biosynthetic process No
GO:0046471 phosphatidylglycerol metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008150 biological_process No
GO:0006793 phosphorus metabolic process No
GO:0019637 organophosphate metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1522 0.1023 0.0646 0.1457 0.9312 0.0726 0.0836 0.071 0.0946 0.0392

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3399
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2712
Ophiocordyceps australis map64 (Brazil) OphauB2|5627
Ophiocordyceps camponoti-floridani Ophcf2|06280 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4972
Ophiocordyceps kimflemingae Ophio5|1720
Ophiocordyceps subramaniannii Hirsu2|6362

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06280
MVLVSAVRLPASSVGSALTRRCVIRSIRLARYSSSSWTSSSSSSSSSSTSTSSTSTSSSTSSTSPSTPSKPPTPS
EDVYDGKWEDSVDFAIRRFDELPHRLFGINQHMIINHELKEALRLMLRQFNAPIVYCFAYGSGVFPQQASASEQR
PESSRSVHSRPPQALTRAQGSSPRMIDFIFGVSHTQHWHSVNMRQHPNHYSAVASLGSGFVSRVQRWGAGVYFNP
YVDVNGMLIKYGVTSIENLVDDLFTWQNLYLAGRLQKPVKILRDHPRVRLANQHNLIAALRTALLLLPAEFDEGQ
LYATIAGLSYLGDPRMALPTEDRSKIANMVCHNAVHFRRLYAPLIRTLPNVVYLQGPVRFDDQSWLLDPRADTRL
RQDMDPVRRANMVRRLPGRFRARLYHRYRKEFGVTADDDDGAGDDSSFEKSVPPTLSFQGGPFDRRIASDDPQRL
HRLIRLVVRQTVNWPSTAQSVKGLLMGGWRRSWRYLGDKFAKWRAGRDKRDNTGKKAQRTKGK*
Coding >Ophcf2|06280
ATGGTCCTCGTTTCTGCCGTTCGTCTTCCGGCTTCGTCCGTGGGCTCGGCCTTGACGCGCCGCTGCGTCATCCGC
TCCATACGTCTCGCCCGATACTCATCATCATCTTGGACCTCTTCCTCTTCCTCTTCCTCTTCCTCTTCCACTTCC
ACTTCCTCTACGTCGACCTCGTCGTCCACCTCTTCAACCTCACCGTCTACACCTTCAAAACCCCCAACCCCATCC
GAAGATGTCTACGATGGCAAGTGGGAAGACTCAGTCGACTTCGCCATCCGCAGATTCGACGAGCTCCCCCATCGT
CTCTTCGGGATTAATCAGCACATGATAATCAACCACGAACTGAAAGAAGCCCTCCGGCTGATGCTCCGTCAGTTC
AACGCCCCGATCGTCTACTGCTTCGCCTACGGCTCCGGCGTCTTCCCCCAGCAGGCTTCCGCCAGCGAACAACGA
CCAGAATCGTCCCGCAGCGTTCATTCTCGTCCGCCACAGGCCCTCACCCGCGCTCAGGGCTCCTCCCCTCGCATG
ATCGACTTCATCTTCGGCGTCAGCCACACGCAGCATTGGCACTCAGTCAACATGCGCCAGCACCCCAATCATTAC
TCGGCCGTCGCCTCCCTCGGCTCAGGCTTCGTCTCGCGCGTTCAGCGATGGGGCGCGGGCGTCTATTTTAACCCG
TACGTAGACGTCAACGGCATGCTGATCAAGTACGGCGTCACCAGCATCGAGAACCTCGTCGACGACCTCTTCACC
TGGCAGAATCTCTACCTCGCAGGCCGTCTACAAAAGCCGGTAAAGATCCTCCGCGACCATCCTCGCGTCCGACTG
GCCAACCAGCACAACCTCATCGCCGCCCTCCGCACCGCCCTCCTCCTCCTCCCAGCCGAGTTCGACGAAGGCCAG
CTGTACGCCACCATCGCCGGCCTCAGCTACCTCGGCGACCCGCGCATGGCCCTCCCAACCGAGGACCGCAGCAAG
ATCGCAAACATGGTCTGCCACAACGCCGTCCACTTCCGCCGTCTGTACGCGCCTCTCATTCGCACCCTTCCCAAC
GTCGTCTACCTCCAGGGCCCAGTCCGCTTCGACGACCAATCCTGGCTCCTTGATCCCCGTGCCGACACCCGTCTG
CGGCAGGATATGGATCCGGTCCGCCGCGCAAACATGGTCCGTCGTCTGCCCGGCCGTTTCCGCGCCCGTCTCTAC
CACCGCTACAGAAAAGAGTTCGGCGTCACGGCTGATGATGACGACGGCGCTGGCGACGACTCTAGCTTCGAGAAG
AGCGTTCCCCCGACCCTGAGCTTCCAGGGCGGACCCTTCGACCGCCGCATCGCCTCAGACGATCCCCAACGACTC
CACCGCCTCATCCGACTTGTCGTCAGACAGACCGTCAACTGGCCCAGCACAGCGCAGAGCGTCAAGGGCTTGTTA
ATGGGCGGCTGGCGGCGCTCGTGGCGCTATCTCGGCGACAAGTTCGCCAAGTGGCGCGCCGGACGAGACAAGCGC
GATAACACAGGAAAGAAAGCACAAAGAACGAAGGGTAAGTAA
Transcript >Ophcf2|06280
ATGGTCCTCGTTTCTGCCGTTCGTCTTCCGGCTTCGTCCGTGGGCTCGGCCTTGACGCGCCGCTGCGTCATCCGC
TCCATACGTCTCGCCCGATACTCATCATCATCTTGGACCTCTTCCTCTTCCTCTTCCTCTTCCTCTTCCACTTCC
ACTTCCTCTACGTCGACCTCGTCGTCCACCTCTTCAACCTCACCGTCTACACCTTCAAAACCCCCAACCCCATCC
GAAGATGTCTACGATGGCAAGTGGGAAGACTCAGTCGACTTCGCCATCCGCAGATTCGACGAGCTCCCCCATCGT
CTCTTCGGGATTAATCAGCACATGATAATCAACCACGAACTGAAAGAAGCCCTCCGGCTGATGCTCCGTCAGTTC
AACGCCCCGATCGTCTACTGCTTCGCCTACGGCTCCGGCGTCTTCCCCCAGCAGGCTTCCGCCAGCGAACAACGA
CCAGAATCGTCCCGCAGCGTTCATTCTCGTCCGCCACAGGCCCTCACCCGCGCTCAGGGCTCCTCCCCTCGCATG
ATCGACTTCATCTTCGGCGTCAGCCACACGCAGCATTGGCACTCAGTCAACATGCGCCAGCACCCCAATCATTAC
TCGGCCGTCGCCTCCCTCGGCTCAGGCTTCGTCTCGCGCGTTCAGCGATGGGGCGCGGGCGTCTATTTTAACCCG
TACGTAGACGTCAACGGCATGCTGATCAAGTACGGCGTCACCAGCATCGAGAACCTCGTCGACGACCTCTTCACC
TGGCAGAATCTCTACCTCGCAGGCCGTCTACAAAAGCCGGTAAAGATCCTCCGCGACCATCCTCGCGTCCGACTG
GCCAACCAGCACAACCTCATCGCCGCCCTCCGCACCGCCCTCCTCCTCCTCCCAGCCGAGTTCGACGAAGGCCAG
CTGTACGCCACCATCGCCGGCCTCAGCTACCTCGGCGACCCGCGCATGGCCCTCCCAACCGAGGACCGCAGCAAG
ATCGCAAACATGGTCTGCCACAACGCCGTCCACTTCCGCCGTCTGTACGCGCCTCTCATTCGCACCCTTCCCAAC
GTCGTCTACCTCCAGGGCCCAGTCCGCTTCGACGACCAATCCTGGCTCCTTGATCCCCGTGCCGACACCCGTCTG
CGGCAGGATATGGATCCGGTCCGCCGCGCAAACATGGTCCGTCGTCTGCCCGGCCGTTTCCGCGCCCGTCTCTAC
CACCGCTACAGAAAAGAGTTCGGCGTCACGGCTGATGATGACGACGGCGCTGGCGACGACTCTAGCTTCGAGAAG
AGCGTTCCCCCGACCCTGAGCTTCCAGGGCGGACCCTTCGACCGCCGCATCGCCTCAGACGATCCCCAACGACTC
CACCGCCTCATCCGACTTGTCGTCAGACAGACCGTCAACTGGCCCAGCACAGCGCAGAGCGTCAAGGGCTTGTTA
ATGGGCGGCTGGCGGCGCTCGTGGCGCTATCTCGGCGACAAGTTCGCCAAGTGGCGCGCCGGACGAGACAAGCGC
GATAACACAGGAAAGAAAGCACAAAGAACGAAGGGTAAGTAA
Gene >Ophcf2|06280
ATGGTCCTCGTTTCTGCCGTTCGTCTTCCGGTGAGAGGCTTTGGCACGTTGTTGAAAGCTGGTGCTGACATTTGT
GCGCTCGCAGGCTTCGTCCGTGGGCTCGGCCTTGACGCGCCGCTGCGTCATCCGCTCCATACGTCTCGCCCGATA
CTCATCATCATCTTGGACCTCTTCCTCTTCCTCTTCCTCTTCCTCTTCCACTTCCACTTCCTCTACGTCGACCTC
GTCGTCCACCTCTTCAACCTCACCGTCTACACCTTCAAAACCCCCAACCCCATCCGAAGATGTCTACGATGGCAA
GTGGGAAGACTCAGTCGACTTCGCCATCCGCAGATTCGACGAGCTCCCCCATCGTCTCTTCGGGATTAATCAGCA
CATGATAATCAACCACGAACTGAAAGAAGCCCTCCGGCTGATGCTCCGTCAGTTCAACGCCCCGATCGTCTACTG
CTTCGCCTACGGCTCCGGCGTCTTCCCCCAGCAGGCTTCCGCCAGCGAACAACGACCAGAATCGTCCCGCAGCGT
TCATTCTCGTCCGCCACAGGCCCTCACCCGCGCTCAGGGCTCCTCCCCTCGCATGATCGACTTCATCTTCGGCGT
CAGCCACACGCAGCATTGGCACTCAGTCAACATGCGCCAGCACCCCAATCATTACTCGGCCGTCGCCTCCCTCGG
CTCAGGCTTCGTCTCGCGCGTTCAGCGATGGGGCGCGGGCGTCTATTTTAACCCGTACGTAGACGTCAACGGCAT
GCTGATCAAGTACGGCGTCACCAGCATCGAGAACCTCGTCGACGACCTCTTCACCTGGCAGAATCTCTACCTCGC
AGGCCGTCTACAAAAGCCGGTAAAGATCCTCCGCGACCATCCTCGCGTCCGACTGGCCAACCAGCACAACCTCAT
CGCCGCCCTCCGCACCGCCCTCCTCCTCCTCCCAGCCGAGTTCGACGAAGGCCAGCTGTACGCCACCATCGCCGG
CCTCAGCTACCTCGGCGACCCGCGCATGGCCCTCCCAACCGAGGACCGCAGCAAGATCGCAAACATGGTCTGCCA
CAACGCCGTCCACTTCCGCCGTCTGTACGCGCCTCTCATTCGCACCCTTCCCAACGTCGTCTACCTCCAGGGCCC
AGTCCGCTTCGACGACCAATCCTGGCTCCTTGATCCCCGTGCCGACACCCGTCTGCGGCAGGATATGGATCCGGT
CCGCCGCGCAAACATGGTCCGTCGTCTGCCCGGCCGTTTCCGCGCCCGTCTCTACCACCGCTACAGAAAAGAGTT
CGGCGTCACGGCTGATGATGACGACGGCGCTGGCGACGACTCTAGCTTCGAGAAGAGCGTTCCCCCGACCCTGAG
CTTCCAGGGCGGACCCTTCGACCGCCGCATCGCCTCAGACGATCCCCAACGACTCCACCGCCTCATCCGACTTGT
CGTCAGACAGACCGTCAACTGGCCCAGCACAGCGCAGAGCGTCAAGGGCTTGTTAATGGGCGGCTGGCGGCGCTC
GTGGCGCTATCTCGGCGACAAGTTCGCCAAGTGGCGCGCCGGACGAGACAAGCGCGATAACACAGGAAAGAAAGC
ACAAAGAACGAAGGGTAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail