Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06279
Gene name
Locationscaffold_07:1770898..1773965
Strand+
Gene length (bp)3067
Transcript length (bp)2793
Coding sequence length (bp)2793
Protein length (aa) 931

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10291 muHD Muniscin C-terminal mu homology domain 1.0E-55 649 929

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.7048 0.2899 0.0933 0.272 0.0546 0.0012 0.1716 0.3577 0.4704 0.0034

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup538
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6603
Ophiocordyceps australis map64 (Brazil) OphauB2|8106
Ophiocordyceps camponoti-floridani Ophcf2|06279 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3074
Ophiocordyceps camponoti-rufipedis Ophun1|4973
Ophiocordyceps kimflemingae Ophio5|1721
Ophiocordyceps subramaniannii Hirsu2|3612
Ophiocordyceps subramaniannii Hirsu2|4185

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06279
MDDVVRTEYPGLLATMMPGQAVSTLNERVKRINRINVEIADWLQERRRVEEQYVLGLRRLAQHRVPNTNSDLGVF
HVPWMRILESVDRIAKSHHLFAERVEKDVEFPLRAYQQRRDYQNMSNISANLAFLARDLDDAQDKAERLNKRGAR
ASSQKVEAANSRLESASQQWESQAPFVFESLQALDEARINQLRDLLTQYQTHEASQAQRAQDNAVEALAAMLEIS
TDKEIKDFARRSAGNKSSLPSQTLHSSHPNPVRFVTRRLSMATAAATAPLHRPLTATAAAPPLPPAAAPGGLPTG
APAAAPTAAMGTGSTAGTAQLAPPPANLVPTAEDGVSDHDSSAPADAKPESKLRRLGTMFGTRRRQSVYGGVAGP
ITAQRTGPSSFGRTTTNHSRGVSPRPSMSNLQDNQGRLSALDEMPDRLERDAPTLPPISSTNGVSTTASENPPRL
SVTGAAADLVGINGGTYDADIEAVAPPPGPPPQQQAAQGSTSPTKDEEGFSVRAPMNDPISEAQREAAGEEADQL
LKLNIQNKPIEEEDPEAKQAALSSVANTLKAGTVTRRSSTLRGRRDNRNTLHLPTSTSSIRESHSDGAMVGSPPL
SASSFSRPTPMAALASESSVAGTSDTQSVRSGNSLGSMGHVRHPEMTGPGLNGSVIETVSAVFEDGEVTSASMTG
EVALVKNASQAGGKAHETIRIKTVLKLERLGPNRIFVHSSSADQPQQFTLDVSHLAKTTTAFSYRVCSEDADAAA
LGARLPLFLKPTWKPQGEKLGLLLQYHLNPTAQLSGPLTLHNVVLVVTYDGNATTAQTRPGGTHLRDKHLVYCRL
GDVTLTTSMQKMVCLIVGTDGVAPTPGHVEARWECVAAGTDAVGSGISISRLNATESEAGAATTATADGPFADDP
FADDGLDAKGQNWVSVPLQRRLVSGKYESK*
Coding >Ophcf2|06279
ATGGATGACGTCGTCAGGACCGAGTATCCCGGCCTGCTGGCCACCATGATGCCCGGCCAAGCTGTCTCGACCCTC
AACGAACGAGTCAAGCGCATCAACAGGATCAACGTCGAGATTGCCGATTGGCTTCAGGAGCGTCGTCGCGTCGAG
GAGCAGTATGTTCTCGGTTTACGCAGACTCGCCCAGCACAGGGTCCCCAATACAAACTCGGATCTAGGAGTCTTC
CATGTTCCCTGGATGCGCATCCTCGAGTCGGTCGATCGCATCGCAAAGTCGCACCACCTGTTCGCCGAGCGCGTC
GAAAAGGACGTCGAGTTCCCCTTGAGAGCCTACCAGCAGCGCCGCGACTATCAAAACATGAGCAACATCTCCGCC
AACCTCGCCTTCTTGGCCAGAGACCTTGACGATGCCCAGGACAAGGCCGAGAGGCTCAACAAGAGGGGCGCCAGG
GCGAGCTCTCAAAAGGTTGAAGCCGCCAACAGCAGGCTCGAGTCGGCCTCTCAGCAGTGGGAGTCGCAGGCGCCC
TTTGTATTCGAGAGTCTACAGGCTTTGGACGAGGCGCGCATCAACCAGCTCCGCGACCTCTTGACCCAATATCAG
ACGCACGAAGCCTCGCAGGCCCAACGCGCCCAGGACAATGCCGTCGAGGCCTTGGCCGCCATGCTCGAGATCAGC
ACCGACAAGGAGATCAAGGACTTTGCGAGACGATCCGCCGGAAACAAATCGTCGCTGCCGTCGCAGACTCTGCAT
TCATCCCATCCCAACCCTGTCCGTTTCGTCACGAGACGCCTGTCCATGGCCACGGCCGCCGCCACCGCGCCTCTT
CACCGGCCTCTCACCGCGACCGCGGCGGCGCCGCCACTGCCACCGGCTGCCGCTCCGGGGGGGCTCCCGACTGGA
GCGCCGGCTGCCGCACCGACCGCTGCGATGGGGACTGGCTCGACGGCTGGCACTGCCCAGTTGGCGCCTCCGCCC
GCGAACCTCGTACCTACCGCCGAGGATGGCGTCAGCGATCACGATTCTTCCGCTCCGGCCGACGCCAAGCCTGAG
TCCAAGCTGCGACGCCTTGGGACTATGTTCGGCACTCGACGGCGGCAGAGCGTCTATGGAGGCGTCGCCGGCCCC
ATCACGGCTCAGAGAACGGGGCCGTCCTCGTTTGGACGGACAACGACCAACCACAGCCGAGGCGTCTCTCCGCGG
CCGTCTATGAGCAATCTTCAAGACAATCAAGGCCGGCTTTCCGCCCTCGACGAGATGCCAGATAGGCTCGAGCGT
GATGCTCCTACCCTGCCCCCTATCTCGTCAACAAACGGGGTATCGACCACGGCGAGCGAAAACCCGCCGCGCCTC
TCCGTAACCGGCGCTGCTGCCGATCTCGTCGGCATAAACGGCGGGACTTACGACGCGGATATTGAGGCCGTTGCT
CCTCCGCCCGGCCCGCCGCCGCAACAGCAAGCAGCTCAGGGGTCGACGTCGCCTACAAAAGACGAAGAGGGCTTC
AGCGTGCGGGCGCCCATGAACGACCCCATCTCCGAGGCTCAGCGCGAGGCAGCCGGCGAAGAAGCCGACCAGCTC
TTAAAGCTCAATATTCAGAACAAACCCATTGAAGAGGAAGACCCCGAGGCCAAGCAGGCTGCTCTGTCCAGCGTG
GCCAACACTCTCAAGGCCGGAACCGTCACCCGCCGTTCCAGCACCCTCCGCGGACGGCGCGATAATCGCAACACC
CTTCACCTCCCGACGTCGACGTCGAGCATACGCGAGAGCCATTCCGACGGAGCCATGGTCGGCTCCCCTCCCCTA
TCGGCTTCTTCCTTTTCCCGTCCGACGCCCATGGCGGCTCTGGCATCGGAATCCAGCGTGGCCGGCACCTCTGAC
ACCCAATCGGTGCGGTCCGGTAACTCGCTGGGCAGTATGGGCCACGTCAGACATCCCGAGATGACGGGCCCGGGG
CTAAACGGCTCCGTCATCGAGACCGTCTCTGCCGTCTTTGAGGATGGAGAGGTGACGAGCGCGTCGATGACGGGA
GAGGTTGCCCTTGTCAAGAATGCCTCCCAAGCAGGCGGGAAGGCACACGAGACGATACGGATCAAGACGGTCTTG
AAACTCGAACGCCTCGGTCCTAACCGCATCTTCGTCCACAGTTCGTCAGCAGACCAGCCGCAACAATTTACGCTC
GACGTCTCCCATTTGGCCAAGACGACGACGGCCTTTTCGTACCGCGTGTGCTCCGAAGACGCTGATGCGGCGGCT
CTCGGTGCTCGACTGCCATTATTCCTCAAACCGACGTGGAAGCCACAGGGCGAGAAGTTAGGCCTTCTGCTGCAG
TACCATCTCAATCCGACGGCACAGCTATCAGGTCCCCTGACGCTTCACAATGTCGTCCTGGTCGTCACGTACGAC
GGTAACGCGACGACGGCGCAGACGAGACCGGGCGGAACGCATCTACGAGACAAACATCTAGTCTACTGTCGTCTC
GGTGACGTAACCCTCACAACAAGCATGCAAAAGATGGTCTGCCTCATCGTCGGAACCGACGGCGTAGCCCCAACA
CCGGGACACGTGGAGGCCAGATGGGAGTGCGTCGCGGCCGGAACCGACGCAGTGGGCAGCGGCATCTCCATCTCG
AGACTGAATGCCACGGAGAGTGAAGCGGGCGCCGCGACGACGGCAACGGCCGACGGTCCCTTCGCTGACGATCCC
TTCGCTGACGATGGTCTTGACGCCAAGGGCCAGAATTGGGTGTCTGTCCCGTTGCAGAGGAGGCTTGTTAGCGGT
AAGTATGAGAGCAAGTAG
Transcript >Ophcf2|06279
ATGGATGACGTCGTCAGGACCGAGTATCCCGGCCTGCTGGCCACCATGATGCCCGGCCAAGCTGTCTCGACCCTC
AACGAACGAGTCAAGCGCATCAACAGGATCAACGTCGAGATTGCCGATTGGCTTCAGGAGCGTCGTCGCGTCGAG
GAGCAGTATGTTCTCGGTTTACGCAGACTCGCCCAGCACAGGGTCCCCAATACAAACTCGGATCTAGGAGTCTTC
CATGTTCCCTGGATGCGCATCCTCGAGTCGGTCGATCGCATCGCAAAGTCGCACCACCTGTTCGCCGAGCGCGTC
GAAAAGGACGTCGAGTTCCCCTTGAGAGCCTACCAGCAGCGCCGCGACTATCAAAACATGAGCAACATCTCCGCC
AACCTCGCCTTCTTGGCCAGAGACCTTGACGATGCCCAGGACAAGGCCGAGAGGCTCAACAAGAGGGGCGCCAGG
GCGAGCTCTCAAAAGGTTGAAGCCGCCAACAGCAGGCTCGAGTCGGCCTCTCAGCAGTGGGAGTCGCAGGCGCCC
TTTGTATTCGAGAGTCTACAGGCTTTGGACGAGGCGCGCATCAACCAGCTCCGCGACCTCTTGACCCAATATCAG
ACGCACGAAGCCTCGCAGGCCCAACGCGCCCAGGACAATGCCGTCGAGGCCTTGGCCGCCATGCTCGAGATCAGC
ACCGACAAGGAGATCAAGGACTTTGCGAGACGATCCGCCGGAAACAAATCGTCGCTGCCGTCGCAGACTCTGCAT
TCATCCCATCCCAACCCTGTCCGTTTCGTCACGAGACGCCTGTCCATGGCCACGGCCGCCGCCACCGCGCCTCTT
CACCGGCCTCTCACCGCGACCGCGGCGGCGCCGCCACTGCCACCGGCTGCCGCTCCGGGGGGGCTCCCGACTGGA
GCGCCGGCTGCCGCACCGACCGCTGCGATGGGGACTGGCTCGACGGCTGGCACTGCCCAGTTGGCGCCTCCGCCC
GCGAACCTCGTACCTACCGCCGAGGATGGCGTCAGCGATCACGATTCTTCCGCTCCGGCCGACGCCAAGCCTGAG
TCCAAGCTGCGACGCCTTGGGACTATGTTCGGCACTCGACGGCGGCAGAGCGTCTATGGAGGCGTCGCCGGCCCC
ATCACGGCTCAGAGAACGGGGCCGTCCTCGTTTGGACGGACAACGACCAACCACAGCCGAGGCGTCTCTCCGCGG
CCGTCTATGAGCAATCTTCAAGACAATCAAGGCCGGCTTTCCGCCCTCGACGAGATGCCAGATAGGCTCGAGCGT
GATGCTCCTACCCTGCCCCCTATCTCGTCAACAAACGGGGTATCGACCACGGCGAGCGAAAACCCGCCGCGCCTC
TCCGTAACCGGCGCTGCTGCCGATCTCGTCGGCATAAACGGCGGGACTTACGACGCGGATATTGAGGCCGTTGCT
CCTCCGCCCGGCCCGCCGCCGCAACAGCAAGCAGCTCAGGGGTCGACGTCGCCTACAAAAGACGAAGAGGGCTTC
AGCGTGCGGGCGCCCATGAACGACCCCATCTCCGAGGCTCAGCGCGAGGCAGCCGGCGAAGAAGCCGACCAGCTC
TTAAAGCTCAATATTCAGAACAAACCCATTGAAGAGGAAGACCCCGAGGCCAAGCAGGCTGCTCTGTCCAGCGTG
GCCAACACTCTCAAGGCCGGAACCGTCACCCGCCGTTCCAGCACCCTCCGCGGACGGCGCGATAATCGCAACACC
CTTCACCTCCCGACGTCGACGTCGAGCATACGCGAGAGCCATTCCGACGGAGCCATGGTCGGCTCCCCTCCCCTA
TCGGCTTCTTCCTTTTCCCGTCCGACGCCCATGGCGGCTCTGGCATCGGAATCCAGCGTGGCCGGCACCTCTGAC
ACCCAATCGGTGCGGTCCGGTAACTCGCTGGGCAGTATGGGCCACGTCAGACATCCCGAGATGACGGGCCCGGGG
CTAAACGGCTCCGTCATCGAGACCGTCTCTGCCGTCTTTGAGGATGGAGAGGTGACGAGCGCGTCGATGACGGGA
GAGGTTGCCCTTGTCAAGAATGCCTCCCAAGCAGGCGGGAAGGCACACGAGACGATACGGATCAAGACGGTCTTG
AAACTCGAACGCCTCGGTCCTAACCGCATCTTCGTCCACAGTTCGTCAGCAGACCAGCCGCAACAATTTACGCTC
GACGTCTCCCATTTGGCCAAGACGACGACGGCCTTTTCGTACCGCGTGTGCTCCGAAGACGCTGATGCGGCGGCT
CTCGGTGCTCGACTGCCATTATTCCTCAAACCGACGTGGAAGCCACAGGGCGAGAAGTTAGGCCTTCTGCTGCAG
TACCATCTCAATCCGACGGCACAGCTATCAGGTCCCCTGACGCTTCACAATGTCGTCCTGGTCGTCACGTACGAC
GGTAACGCGACGACGGCGCAGACGAGACCGGGCGGAACGCATCTACGAGACAAACATCTAGTCTACTGTCGTCTC
GGTGACGTAACCCTCACAACAAGCATGCAAAAGATGGTCTGCCTCATCGTCGGAACCGACGGCGTAGCCCCAACA
CCGGGACACGTGGAGGCCAGATGGGAGTGCGTCGCGGCCGGAACCGACGCAGTGGGCAGCGGCATCTCCATCTCG
AGACTGAATGCCACGGAGAGTGAAGCGGGCGCCGCGACGACGGCAACGGCCGACGGTCCCTTCGCTGACGATCCC
TTCGCTGACGATGGTCTTGACGCCAAGGGCCAGAATTGGGTGTCTGTCCCGTTGCAGAGGAGGCTTGTTAGCGGT
AAGTATGAGAGCAAGTAG
Gene >Ophcf2|06279
ATGGATGACGTCGTCAGGACCGAGTATCCCGGCCTGCTGGTGAGGCTCAGCCTGCGACAGAATCTGCCTGATTGT
TCGCTGACTGACCGCTCAGGCCACCATGATGCCCGGCCAAGCTGTCTCGACCCTCAACGAACGAGTCAAGCGCAT
CAACAGGATCAACGTCGAGATTGCCGATTGGCTTCAGGTAGCTCGTTGTCTATTGCTTGAACCTCGCCTGGAGTC
TGACTTGGAATACAGGAGCGTCGTCGCGTCGAGGAGCAGTATGTTCTCGGTTTACGCAGACTCGCCCAGCACAGG
GTCCCCAATACAAACTCGGATCTAGGGTTTGTTCTCCGCCTTCGCTCGCGCAGACATGTCCTCTTGCTGACCAAA
GCTTCCCAGAGTCTTCCATGTTCCCTGGATGCGCATCCTCGAGTCGGTCGATCGCATCGCAAAGTCGCACCACCT
GTTCGCCGAGCGCGTCGAAAAGGACGTCGAGTTCCCCTTGAGAGCCTACCAGCAGCGCCGCGACTATCAAAACAT
GAGCAACATCTCCGCCAACCTCGCCTTCTTGGCCAGAGACCTTGACGATGCCCAGGACAAGGCCGAGAGGCTCAA
CAAGAGGGGCGCCAGGGCGAGCTCTCAAAAGGTTGAAGCCGCCAACAGCAGGCTCGAGTCGGCCTCTCAGCAGTG
GGAGTCGCAGGCGCCCTTTGTATTCGAGAGTCTACAGGCTTTGGACGAGGCGCGCATCAACCAGCTCCGCGACCT
CTTGACCCAATATCAGACGCACGAAGCCTCGCAGGCCCAACGCGCCCAGGACAATGCCGTCGAGGCCTTGGCCGC
CATGCTCGAGATCAGCACCGACAAGGAGATCAAGGACTTTGCGAGACGATCCGCCGGAAACAAATCGTCGCTGCC
GTCGCAGACTCTGCATTCATCCCATCCCAACCCTGTCCGTTTCGTCACGAGACGCCTGTCCATGGCCACGGCCGC
CGCCACCGCGCCTCTTCACCGGCCTCTCACCGCGACCGCGGCGGCGCCGCCACTGCCACCGGCTGCCGCTCCGGG
GGGGCTCCCGACTGGAGCGCCGGCTGCCGCACCGACCGCTGCGATGGGGACTGGCTCGACGGCTGGCACTGCCCA
GTTGGCGCCTCCGCCCGCGAACCTCGTACCTACCGCCGAGGATGGCGTCAGCGATCACGATTCTTCCGCTCCGGC
CGACGCCAAGCCTGGTAAGCCCTCTTCAATATTGACGAGGCCTGATGCCCCTGACCGTCATGCAGAGTCCAAGCT
GCGACGCCTTGGGACTATGTTCGGCACTCGACGGCGGCAGAGCGTCTATGGAGGCGTCGCCGGCCCCATCACGGC
TCAGAGAACGGGGCCGTCCTCGTTTGGACGGACAACGACCAACCACAGCCGAGGCGTCTCTCCGCGGCCGTCTAT
GAGCAATCTTCAAGACAATCAAGGCCGGCTTTCCGCCCTCGACGAGATGCCAGATAGGCTCGAGCGTGATGCTCC
TACCCTGCCCCCTATCTCGTCAACAAACGGGGTATCGACCACGGCGAGCGAAAACCCGCCGCGCCTCTCCGTAAC
CGGCGCTGCTGCCGATCTCGTCGGCATAAACGGCGGGACTTACGACGCGGATATTGAGGCCGTTGCTCCTCCGCC
CGGCCCGCCGCCGCAACAGCAAGCAGCTCAGGGGTCGACGTCGCCTACAAAAGACGAAGAGGGCTTCAGCGTGCG
GGCGCCCATGAACGACCCCATCTCCGAGGCTCAGCGCGAGGCAGCCGGCGAAGAAGCCGACCAGCTCTTAAAGCT
CAATATTCAGAACAAACCCATTGAAGAGGAAGACCCCGAGGCCAAGCAGGCTGCTCTGTCCAGCGTGGCCAACAC
TCTCAAGGCCGGAACCGTCACCCGCCGTTCCAGCACCCTCCGCGGACGGCGCGATAATCGCAACACCCTTCACCT
CCCGACGTCGACGTCGAGCATACGCGAGAGCCATTCCGACGGAGCCATGGTCGGCTCCCCTCCCCTATCGGCTTC
TTCCTTTTCCCGTCCGACGCCCATGGCGGCTCTGGCATCGGAATCCAGCGTGGCCGGCACCTCTGACACCCAATC
GGTGCGGTCCGGTAACTCGCTGGGCAGTATGGGCCACGTCAGACATCCCGAGATGACGGGCCCGGGGCTAAACGG
CTCCGTCATCGAGACCGTCTCTGCCGTCTTTGAGGATGGAGAGGTGACGAGCGCGTCGATGACGGGAGAGGTTGC
CCTTGTCAAGAATGCCTCCCAAGCAGGCGGGAAGGGTATGTCGAGGGAGGGCTCTTGTCTGATGGCTACCGTGAC
TGACCGAGAGGGAGAAGCACACGAGACGATACGGATCAAGACGGTCTTGAAACTCGAACGCCTCGGTCCTAACCG
CATCTTCGTCCACAGTTCGTCAGCAGACCAGCCGCAACAATTTACGCTCGACGTCTCCCATTTGGCCAAGACGAC
GACGGCCTTTTCGTACCGCGTGTGCTCCGAAGACGCTGATGCGGCGGCTCTCGGTGCTCGACTGCCATTATTCCT
CAAACCGACGTGGAAGCCACAGGGCGAGAAGTTAGGCCTTCTGCTGCAGTACCATCTCAATCCGACGGCACAGCT
ATCAGGTCCCCTGACGCTTCACAATGTCGTCCTGGTCGTCACGTACGACGGTAACGCGACGACGGCGCAGACGAG
ACCGGGCGGAACGCATCTACGAGACAAACATCTAGTCTACTGTCGTCTCGGTGACGTAACCCTCACAACAAGCAT
GCAAAAGATGGTCTGCCTCATCGTCGGAACCGACGGCGTAGCCCCAACACCGGGACACGTGGAGGCCAGATGGGA
GTGCGTCGCGGCCGGAACCGACGCAGTGGGCAGCGGCATCTCCATCTCGAGACTGAATGCCACGGAGAGTGAAGC
GGGCGCCGCGACGACGGCAACGGCCGACGGTCCCTTCGCTGACGATCCCTTCGCTGACGATGGTCTTGACGCCAA
GGGCCAGAATTGGGTGTCTGTCCCGTTGCAGAGGAGGCTTGTTAGCGGTAAGTATGAGAGCAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail