Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06275
Gene name
Locationscaffold_07:1759726..1761007
Strand+
Gene length (bp)1281
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family 6.3E-62 31 301

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2003 0.8802 0.3062 0.02 0.1753 0.0172 0.0435 0.0064 0.0416 0.0009

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2650
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4394
Ophiocordyceps australis map64 (Brazil) OphauB2|8101
Ophiocordyceps camponoti-floridani Ophcf2|06275 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3070
Ophiocordyceps kimflemingae Ophio5|1727
Ophiocordyceps subramaniannii Hirsu2|4068

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06275
MASSKKVIVVASDAVTPIDPDQTLKASKALLAHIQKAAKEGAEKAADHASKRNLLDDDDDVRDTPIWLTLTTKRH
LAGTTRLKPAKIPLPHSLNEDGMTTICAITADPQRVYKDIIASPEFPAALGKRITRVIDFSKLKAKYSRYEAQRK
LLSEHDIFVADDRIVNRLPKVLGKTFYTSTQKRPIPVIFETKRTKVNGKLVGHKKRTAAAAAAAAGDGVGSAKSI
NTASAADMAKEINKAIGCALVSLSPAVNTSVRVAYAHWEPEHVAANVTAVASALVEKWVPHQWRNVKSIYIKGPT
TAALPIWQTDQLWLDEADVVADADDDRDFLDGVEKANIGKKRKSLDGQPVEEAAPKTKKAKTSTSRPQRRNKAKA
GDDDDGELEKQVAQRKATLRKQKAAAKRDMDG*
Coding >Ophcf2|06275
ATGGCGTCTTCTAAAAAGGTCATTGTCGTTGCCTCCGACGCCGTGACCCCAATCGACCCCGACCAGACGCTCAAG
GCCTCCAAAGCGCTGCTTGCCCATATCCAAAAGGCGGCGAAAGAGGGCGCTGAAAAAGCGGCGGATCATGCATCG
AAGCGCAATTTACTCGACGACGATGACGATGTGCGGGATACGCCCATCTGGCTAACGTTGACGACGAAGCGACAC
TTGGCCGGCACGACCCGGCTCAAGCCCGCCAAGATCCCGCTGCCACATTCGCTGAACGAGGATGGGATGACAACC
ATCTGTGCCATAACCGCCGACCCTCAGCGCGTCTACAAGGACATCATCGCCTCGCCCGAGTTCCCCGCCGCTCTC
GGCAAGCGCATCACCCGCGTCATTGATTTCTCCAAGCTCAAGGCAAAGTACAGCCGGTACGAAGCCCAACGAAAG
CTCCTCTCGGAACATGACATCTTCGTCGCCGACGACCGCATCGTCAATCGCCTGCCAAAGGTCCTCGGTAAGACA
TTTTACACGTCGACCCAGAAGCGGCCCATCCCCGTCATCTTCGAGACCAAACGCACAAAGGTCAACGGCAAGCTT
GTCGGTCACAAGAAGAGGACTGCTGCTGCTGCTGCTGCTGCTGCTGGTGACGGTGTCGGCTCAGCCAAGTCCATC
AACACCGCTTCGGCCGCCGACATGGCCAAGGAGATCAACAAAGCCATCGGCTGCGCCCTCGTCAGCCTATCCCCC
GCGGTGAATACGTCCGTCCGCGTTGCCTACGCTCACTGGGAACCGGAGCACGTAGCCGCCAACGTGACCGCCGTC
GCCTCGGCCCTCGTCGAGAAGTGGGTGCCTCATCAATGGCGTAACGTCAAGAGCATCTACATCAAGGGTCCCACT
ACGGCCGCTCTGCCCATCTGGCAGACCGACCAGCTGTGGCTGGACGAGGCTGACGTTGTCGCCGACGCCGATGAC
GACCGCGACTTCTTGGACGGAGTGGAAAAGGCCAACATCGGAAAGAAGCGCAAGTCGCTCGATGGCCAACCTGTC
GAGGAAGCAGCGCCCAAGACCAAAAAGGCCAAGACGTCCACCTCCCGGCCGCAGCGCCGTAACAAGGCCAAGGCC
GGCGACGACGACGATGGCGAACTGGAAAAGCAGGTAGCGCAGCGTAAGGCCACGCTGCGGAAGCAAAAGGCTGCT
GCCAAAAGAGACATGGACGGCTGA
Transcript >Ophcf2|06275
ATGGCGTCTTCTAAAAAGGTCATTGTCGTTGCCTCCGACGCCGTGACCCCAATCGACCCCGACCAGACGCTCAAG
GCCTCCAAAGCGCTGCTTGCCCATATCCAAAAGGCGGCGAAAGAGGGCGCTGAAAAAGCGGCGGATCATGCATCG
AAGCGCAATTTACTCGACGACGATGACGATGTGCGGGATACGCCCATCTGGCTAACGTTGACGACGAAGCGACAC
TTGGCCGGCACGACCCGGCTCAAGCCCGCCAAGATCCCGCTGCCACATTCGCTGAACGAGGATGGGATGACAACC
ATCTGTGCCATAACCGCCGACCCTCAGCGCGTCTACAAGGACATCATCGCCTCGCCCGAGTTCCCCGCCGCTCTC
GGCAAGCGCATCACCCGCGTCATTGATTTCTCCAAGCTCAAGGCAAAGTACAGCCGGTACGAAGCCCAACGAAAG
CTCCTCTCGGAACATGACATCTTCGTCGCCGACGACCGCATCGTCAATCGCCTGCCAAAGGTCCTCGGTAAGACA
TTTTACACGTCGACCCAGAAGCGGCCCATCCCCGTCATCTTCGAGACCAAACGCACAAAGGTCAACGGCAAGCTT
GTCGGTCACAAGAAGAGGACTGCTGCTGCTGCTGCTGCTGCTGCTGGTGACGGTGTCGGCTCAGCCAAGTCCATC
AACACCGCTTCGGCCGCCGACATGGCCAAGGAGATCAACAAAGCCATCGGCTGCGCCCTCGTCAGCCTATCCCCC
GCGGTGAATACGTCCGTCCGCGTTGCCTACGCTCACTGGGAACCGGAGCACGTAGCCGCCAACGTGACCGCCGTC
GCCTCGGCCCTCGTCGAGAAGTGGGTGCCTCATCAATGGCGTAACGTCAAGAGCATCTACATCAAGGGTCCCACT
ACGGCCGCTCTGCCCATCTGGCAGACCGACCAGCTGTGGCTGGACGAGGCTGACGTTGTCGCCGACGCCGATGAC
GACCGCGACTTCTTGGACGGAGTGGAAAAGGCCAACATCGGAAAGAAGCGCAAGTCGCTCGATGGCCAACCTGTC
GAGGAAGCAGCGCCCAAGACCAAAAAGGCCAAGACGTCCACCTCCCGGCCGCAGCGCCGTAACAAGGCCAAGGCC
GGCGACGACGACGATGGCGAACTGGAAAAGCAGGTAGCGCAGCGTAAGGCCACGCTGCGGAAGCAAAAGGCTGCT
GCCAAAAGAGACATGGACGGCTGA
Gene >Ophcf2|06275
ATGGCGTCTTCTAAAAAGGTCATTGTCGTTGCCTCCGACGCCGTGACCCCAATCGACCCCGACCAGGTTCGCATC
CTCCCCGATCTCTTATAACCAGTTGTCCGGATGCTTATATCTTCTCAGACGCTCAAGGCCTCCAAAGCGCTGCTT
GCCCATATCCAAAAGGCGGCGAAAGAGGGCGCTGAAAAAGCGGCGGATCATGCATCGAAGCGCAATTTACTCGAC
GACGATGACGATGTGCGGGATACGCCCATCTGGCTAACGTTGACGACGAAGCGACACTTGGCCGGCACGACCCGG
CTCAAGCCCGCCAAGATCCCGCTGCCACATTCGCTGAACGAGGATGGGATGACAACCATCTGTGCCATAACCGCC
GACCCTCAGCGCGTCTACAAGGACATCATCGCCTCGCCCGAGTTCCCCGCCGCTCTCGGCAAGCGCATCACCCGC
GTCATTGATTTCTCCAAGCTCAAGGCAAAGTACAGCCGGTACGAAGCCCAACGAAAGCTCCTCTCGGAACATGAC
ATCTTCGTCGCCGACGACCGCATCGTCAATCGCCTGCCAAAGGTCCTCGGTAAGACATTTTACACGTCGACCCAG
AAGCGGCCCATCCCCGTCATCTTCGAGACCAAACGCACAAAGGTCAACGGCAAGCTTGTCGGTCACAAGAAGAGG
ACTGCTGCTGCTGCTGCTGCTGCTGCTGGTGACGGTGTCGGCTCAGCCAAGTCCATCAACACCGCTTCGGCCGCC
GACATGGCCAAGGAGATCAACAAAGCCATCGGCTGCGCCCTCGTCAGCCTATCCCCCGCGGTGAATACGTCCGTC
CGCGTTGCCTACGCTCACTGGGAACCGGAGCACGTAGCCGCCAACGTGACCGCCGTCGCCTCGGCCCTCGTCGAG
AAGTGGGTGCCTCATCAATGGCGTAACGTCAAGAGCATCTACATCAAGGGTCCCACTACGGCCGCTCTGCCCATC
TGGCAGACCGACCAGCTGTGGCTGGACGAGGCTGACGTTGTCGCCGACGCCGATGACGACCGCGACTTCTTGGAC
GGAGTGGAAAAGGCCAACATCGGAAAGAAGCGCAAGTCGCTCGATGGCCAACCTGTCGAGGAAGCAGCGCCCAAG
ACCAAAAAGGCCAAGACGTCCACCTCCCGGCCGCAGCGCCGTAACAAGGCCAAGGCCGGCGACGACGACGATGGC
GAACTGGAAAAGCAGGTAGCGCAGCGTAAGGCCACGCTGCGGAAGCAAAAGGCTGCTGCCAAAAGAGACATGGAC
GGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail