Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06269
Gene name
Locationscaffold_07:1742580..1743637
Strand+
Gene length (bp)1057
Transcript length (bp)843
Coding sequence length (bp)843
Protein length (aa) 281

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03661 TMEM33_Pom33 Transmembrane protein 33/Nucleoporin POM33 4.1E-31 16 255

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 50 72 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06269
MPNKTNMSLQERLLALAKTLQFAWFIGHMTLLTSTLRYFMSWLRMNYYSGWAQGSYRASFVAAIVTYGIVVYKTQ
RARAKMNSRPSGGLIGQLSDENVQYLLMALVWLFSPQYPLALLPYSVYSVFHVATYTRTNLIPACQAPPPPAADG
SARPRVNSPLADRIGNFVKEYYETSMSVVSGMELLLWVRILFSAILFQRRSWILICLYTAFIRARYSQSTHMQSS
IAQLCARIDSLVGAQGTPPAARQAWDSIKNGTRQFHDATEMGKYVSAGGPAKKTS*
Coding >Ophcf2|06269
ATGCCCAACAAGACCAATATGTCGCTCCAGGAGCGGCTCCTGGCTCTGGCCAAGACGCTGCAGTTCGCCTGGTTT
ATCGGGCACATGACGCTCCTCACATCGACGCTGCGATATTTCATGTCGTGGTTGCGAATGAATTATTATAGCGGC
TGGGCGCAGGGCTCGTATCGGGCATCATTCGTCGCCGCCATCGTCACGTACGGCATCGTCGTCTACAAGACGCAA
CGGGCGCGCGCCAAGATGAACTCTAGGCCTTCGGGTGGCCTCATCGGTCAGCTCTCGGACGAAAACGTGCAATAC
CTGCTCATGGCCCTCGTCTGGCTCTTTTCCCCTCAGTATCCCCTGGCGCTGCTGCCCTATTCAGTCTACTCCGTC
TTTCACGTCGCCACCTACACTCGCACCAACCTCATCCCCGCCTGTCAAGCGCCTCCACCGCCTGCCGCCGACGGC
TCTGCTCGGCCCAGGGTCAACAGTCCGCTGGCCGATAGGATCGGCAATTTCGTCAAGGAGTACTACGAGACGTCA
ATGTCCGTCGTCTCGGGCATGGAACTGCTCCTCTGGGTGCGCATCCTGTTCTCGGCCATCCTCTTCCAGCGCAGG
TCCTGGATCCTCATCTGCCTCTACACGGCCTTCATCCGCGCCCGCTACTCGCAGAGCACCCACATGCAGAGTTCC
ATAGCCCAGCTCTGCGCCCGCATCGACTCTCTTGTCGGCGCTCAGGGAACGCCCCCGGCTGCGCGTCAGGCCTGG
GACAGCATCAAGAATGGGACCCGGCAGTTCCACGACGCCACCGAGATGGGCAAATATGTCAGCGCCGGCGGTCCG
GCCAAGAAGACGTCGTGA
Transcript >Ophcf2|06269
ATGCCCAACAAGACCAATATGTCGCTCCAGGAGCGGCTCCTGGCTCTGGCCAAGACGCTGCAGTTCGCCTGGTTT
ATCGGGCACATGACGCTCCTCACATCGACGCTGCGATATTTCATGTCGTGGTTGCGAATGAATTATTATAGCGGC
TGGGCGCAGGGCTCGTATCGGGCATCATTCGTCGCCGCCATCGTCACGTACGGCATCGTCGTCTACAAGACGCAA
CGGGCGCGCGCCAAGATGAACTCTAGGCCTTCGGGTGGCCTCATCGGTCAGCTCTCGGACGAAAACGTGCAATAC
CTGCTCATGGCCCTCGTCTGGCTCTTTTCCCCTCAGTATCCCCTGGCGCTGCTGCCCTATTCAGTCTACTCCGTC
TTTCACGTCGCCACCTACACTCGCACCAACCTCATCCCCGCCTGTCAAGCGCCTCCACCGCCTGCCGCCGACGGC
TCTGCTCGGCCCAGGGTCAACAGTCCGCTGGCCGATAGGATCGGCAATTTCGTCAAGGAGTACTACGAGACGTCA
ATGTCCGTCGTCTCGGGCATGGAACTGCTCCTCTGGGTGCGCATCCTGTTCTCGGCCATCCTCTTCCAGCGCAGG
TCCTGGATCCTCATCTGCCTCTACACGGCCTTCATCCGCGCCCGCTACTCGCAGAGCACCCACATGCAGAGTTCC
ATAGCCCAGCTCTGCGCCCGCATCGACTCTCTTGTCGGCGCTCAGGGAACGCCCCCGGCTGCGCGTCAGGCCTGG
GACAGCATCAAGAATGGGACCCGGCAGTTCCACGACGCCACCGAGATGGGCAAATATGTCAGCGCCGGCGGTCCG
GCCAAGAAGACGTCGTGA
Gene >Ophcf2|06269
ATGCCCAACAAGACCAATATGTCGCTCCAGGAGCGGCTCCTGGCTCTGGCCAAGACGCTGCAGTGTACGATGGCG
CCCATCTGAACCCTCCCTGCGCAACTCGCGTCGCTGACCTTGCTGCTGCGTGGCTTCCAGTCGCCTGGTTTATCG
GGTGCGTCTAGCTCACGGCTGCTGCTCTCGATGCCATGTTTGCTTTGCTGATTGGGTTTCTCTCCTTGCGATAGG
CACATGACGCTCCTCACATCGACGCTGCGATATTTCATGTCGTGGTTGCGAATGAATTATTATAGCGGCTGGGCG
CAGGGCTCGTATCGGGCATCATTCGTCGCCGCCATCGTCACGTACGGCATCGTCGTCTACAAGACGCAACGGGCG
CGCGCCAAGATGAACTCTAGGCCTTCGGGTGGCCTCATCGGTCAGCTCTCGGACGAAAACGTGCAATACCTGCGT
ACGAAAATCCCCACCTCCTTGCCCCTTGTCGCTGTGGCTGACCGTCGACGCCCATCTCGTGTCTGCAGTCATGGC
CCTCGTCTGGCTCTTTTCCCCTCAGTATCCCCTGGCGCTGCTGCCCTATTCAGTCTACTCCGTCTTTCACGTCGC
CACCTACACTCGCACCAACCTCATCCCCGCCTGTCAAGCGCCTCCACCGCCTGCCGCCGACGGCTCTGCTCGGCC
CAGGGTCAACAGTCCGCTGGCCGATAGGATCGGCAATTTCGTCAAGGAGTACTACGAGACGTCAATGTCCGTCGT
CTCGGGCATGGAACTGCTCCTCTGGGTGCGCATCCTGTTCTCGGCCATCCTCTTCCAGCGCAGGTCCTGGATCCT
CATCTGCCTCTACACGGCCTTCATCCGCGCCCGCTACTCGCAGAGCACCCACATGCAGAGTTCCATAGCCCAGCT
CTGCGCCCGCATCGACTCTCTTGTCGGCGCTCAGGGAACGCCCCCGGCTGCGCGTCAGGCCTGGGACAGCATCAA
GAATGGGACCCGGCAGTTCCACGACGCCACCGAGATGGGCAAATATGTCAGCGCCGGCGGTCCGGCCAAGAAGAC
GTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail